DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and H41C03.1

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_495168.1 Gene:H41C03.1 / 173994 WormBaseID:WBGene00019268 Length:396 Species:Caenorhabditis elegans


Alignment Length:210 Identity:42/210 - (20%)
Similarity:75/210 - (35%) Gaps:38/210 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QRLLELNYGLRNKHAHIFIDRDPL--DASSQQLLQVADLVPLPGLTPENNKLLF----------- 105
            :.|.||...||.:.   :.|.|.:  :.....:|:....:.|.|.|.::|:||.           
 Worm    43 EALAELRRHLRFRQ---YYDLDNILTNVPDHPILKKYFPLGLVGETGKDNQLLVIECAGRIDLMG 104

  Fly   106 ----YRLIDFDADKFNFTAAIKVFFMVADCRFATENEERLSDGE----IPVFDMAGYTL-RHLTK 161
                ..|.||...:|.|...:          .|..||.....|.    |.:.|:.|... ..|..
 Worm   105 ILKSVHLSDFLIQRFKFQEKM----------LAAMNEMERKYGTQCSVIYILDLEGLKFDPALIS 159

  Fly   162 TALGALRVYMKFVQEAHPVRLKEIHVLNCPSYVDKVMAVVKPFIKGEVFKLIHFHLPNAD---TP 223
            ...|..|:....|..|:|..:..:.::|.||::..:...:.|.:.......:.....|:|   :.
 Worm   160 IVTGPYRILWASVYTAYPEWINTLFLINAPSFMTLLWKAIGPLLPERTRNKVRICSGNSDWKTSV 224

  Fly   224 YRHFPRSMLPEEYGG 238
            .:|.....:|:.:||
 Worm   225 QKHAHIDNIPKHWGG 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 34/172 (20%)
H41C03.1NP_495168.1 SEC14 69..242 CDD:214706 35/181 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.