DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and CLVS1

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_775790.1 Gene:CLVS1 / 157807 HGNCID:23139 Length:354 Species:Homo sapiens


Alignment Length:297 Identity:62/297 - (20%)
Similarity:126/297 - (42%) Gaps:33/297 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VHLNEKAEDQLMTTRISDLQDWLQAQPQLP-QNISRLLLRRFLHTTRGDLSAAQRLLELNYGLRN 65
            :.|||..:  ::...|..::|.:..:|.:. .......:.|||...:...:.|.|||...:..|.
Human    40 LELNENPD--VLHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQYRQ 102

  Fly    66 KHAHIFIDRDPLDASSQQLLQVADLVPLPGLTPEN-----NKLLFYRLIDFDADKFNFTAAIKVF 125
            .:..:|.:....|...::.|    :...||:. ||     .|:|.....::|..:.:||..::..
Human   103 LNLDMFKNFKADDPGIKRAL----IDGFPGVL-ENRDHYGRKILLLFAANWDQSRNSFTDILRAI 162

  Fly   126 FMVADCRFATENEERLSDGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEAHPVRLKEIHVLNC 190
            .:  ......|:.|...:|.|.:.|.:.::.:..:|.....|::.::.:|::.|.|...:|.:|.
Human   163 LL--SLEVLIEDPELQINGFILIIDWSNFSFKQASKLTPSILKLAIEGLQDSFPARFGGVHFVNQ 225

  Fly   191 PSYVDKVMAVVKPFIKGEVFKLIHFHLPNADTPYRHFPRSMLPEEYGG-----EAGKMSDLKLQW 250
            |.|:..:..::|||:|.:..|.|..|..|.::.::......||.|:||     :.|       .|
Human   226 PWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIHPEFLPSEFGGTLPPYDMG-------TW 283

  Fly   251 MQLL-----KEQRDYLMDTEN-WQINKIKKNGQRKSS 281
            .:.|     .::.||...:.| ..:.....|.:|:.|
Human   284 ARTLLGPDYSDENDYTHTSYNAMHVKHTSSNLERECS 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 36/158 (23%)
CLVS1NP_775790.1 CRAL_TRIO_N 51..97 CDD:215024 10/45 (22%)
CRAL_TRIO 125..274 CDD:306996 35/151 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145884
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.