DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and CLVS2

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001010852.2 Gene:CLVS2 / 134829 HGNCID:23046 Length:327 Species:Homo sapiens


Alignment Length:307 Identity:66/307 - (21%)
Similarity:129/307 - (42%) Gaps:38/307 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVHLN--------EKAEDQL------MTTRISDLQDWLQAQPQLP-QNISRLLLRRFLHTTRGDL 50
            |.||.        |||..:|      :...|.:::|.:..:|.:. .......:.|||...:...
Human     1 MTHLQAGLSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHH 65

  Fly    51 SAAQRLLELNYGLRNKHAHIFIDRDPLDASSQQLLQVADLVP--LPGLTPENNKLLFYRLIDFDA 113
            ..|.|||...:..|.::..:|......|...:|.|:  |..|  |..|.....|:|.....::|.
Human    66 FEAFRLLAQYFEYRQQNLDMFKSFKATDPGIKQALK--DGFPGGLANLDHYGRKILVLFAANWDQ 128

  Fly   114 DKFNFTAAIKVFFMVADCRFATENEERLSDGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEAH 178
            .::.....::...:..:...  |:.|...:|.:.:.|.:.:|.:..:|.....||:.::.:|::.
Human   129 SRYTLVDILRAILLSLEAMI--EDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSF 191

  Fly   179 PVRLKEIHVLNCPSYVDKVMAVVKPFIKGEVFKLIHFHLPNADTPYRHFPRSMLPEEYGG----- 238
            |.|...||.:|.|.|:..:..|::||:|.:..|.|..|..|.::.::.....:||.|:||     
Human   192 PARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGMLPPY 256

  Fly   239 EAGKMSDLKLQWMQLL-----KEQRDYLMDTENWQINKIKKNGQRKS 280
            :.|       .|.:.|     .:..:|.:|:.:..:.:::|....||
Human   257 DMG-------TWARTLLDHEYDDDSEYNVDSYSMPVKEVEKELSPKS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 35/155 (23%)
CLVS2NP_001010852.2 CRAL_TRIO_N 29..75 CDD:215024 10/45 (22%)
SEC14 106..251 CDD:238099 32/146 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145896
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.