DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and Sec14l2

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_446253.2 Gene:Sec14l2 / 116486 RGDID:621779 Length:403 Species:Rattus norvegicus


Alignment Length:250 Identity:61/250 - (24%)
Similarity:98/250 - (39%) Gaps:29/250 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNEKAEDQLMTTRISDLQDWLQAQPQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYGLR-NKH 67
            |:.|.|:.|...| .::||.|.|.|    |.....|.|:|.....||..::.:|..:...| .|.
  Rat     8 LSPKQEEALAKFR-ENVQDVLPALP----NPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKD 67

  Fly    68 AHIFIDRDPLDASSQQLLQVA---DLVPLPGLTPENNKLLFYRLI-DFDADKFNFTAAIKVF--- 125
            ....|...|.:...|.|....   ||...|         ::|.:| ..||....|:|:.:..   
  Rat    68 IDKIISWQPPEVIQQYLSGGRCGYDLDGCP---------VWYDIIGPLDAKGLLFSASKQDLLRT 123

  Fly   126 ------FMVADCRFATENEERLSDGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEAHPVRLKE 184
                  .::.:|...|....:..:....::|..|..|:||.|.|:.|...::...:|.:|..||.
  Rat   124 KMRDCELLLQECTHQTAKLGKKIETITMIYDCEGLGLKHLWKPAVEAYGEFLTMFEENYPETLKR 188

  Fly   185 IHVLNCPSYVDKVMAVVKPFIKGEVFKLIHFHLPN-ADTPYRHFPRSMLPEEYGG 238
            :.|:..|........::|||:..:..|.|.....| .:...:|.....||.||||
  Rat   189 LFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQLPVEYGG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 36/159 (23%)
Sec14l2NP_446253.2 CRAL_TRIO_N 13..59 CDD:215024 15/50 (30%)
SEC14 76..244 CDD:214706 40/176 (23%)
GOLD_2 300..381 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.