DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and sec14l1

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_012825399.2 Gene:sec14l1 / 100124776 XenbaseID:XB-GENE-5823346 Length:717 Species:Xenopus tropicalis


Alignment Length:96 Identity:22/96 - (22%)
Similarity:43/96 - (44%) Gaps:8/96 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 DMAGYTLRHLTKTALGALRVYMKFVQEAHPVRLKEIHVLNCPSYVDKVMAVVKPFI------KGE 208
            |:.|..:|||.:..:.||...::.|:..:|..|..:.::..|.....:..:|.|||      |..
 Frog   403 DLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLIVRAPRVFPVLWTLVSPFINENSRQKFL 467

  Fly   209 VFKLIHFHLPNADTPYRHFPRSMLPEEYGGE 239
            ::...::..|.....|  ..:.::|:..|||
 Frog   468 IYSGNNYQGPGGIADY--VDKEIVPDFLGGE 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 20/94 (21%)
sec14l1XP_012825399.2 PRELI 17..173 CDD:398400
CRAL_TRIO_N 252..307 CDD:215024
CRAL_TRIO 332..496 CDD:395525 20/94 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.