DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG12219 and Sry-delta

DIOPT Version :9

Sequence 1:	NP_572312.1	Gene:	CG12219 / 31572	FlyBaseID:	FBgn0043796	Length:	562	Species:	Drosophila melanogaster
Sequence 2:	NP_524581.1	Gene:	Sry-delta / 43572	FlyBaseID:	FBgn0003512	Length:	433	Species:	Drosophila melanogaster

Alignment Length:	118	Identity:	29/118 - (24%)
Similarity:	48/118 - (40%)	Gaps:	17/118 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly   452 CPNCGELPG-----QNH---RCLSKPKYACDVCGKSFKMKRYLEEHFATHTGVKLHTCAFCPTEF 508
            |..||::..     |.|   ....:|.:.|.:||...:.:.|||.|...|.|.....|.:||..|
  Fly   196 CTTCGKVYNSWYQLQKHISEEHSKQPNHICPICGVIRRDEEYLELHMNLHEGKTEKQCRYCPKSF 260

  Fly   509 RSKSNMYHHTKRKHKAEWERSRATRSAAKAGV---QEQMQHTNPSQAQAQPGP 558
            ....|...| .|.|   |::.:  ....|.|:   |:.:.:.:..:.:|:..|
  Fly   261 SRPVNTLRH-MRMH---WDKKK--YQCEKCGLRFSQDNLLYNHRLRHEAEENP 307

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG12219	NP_572312.1	zf-AD	2..94	CDD:285071
		C2H2 Zn finger	140..160	CDD:275368
		COG4049	149..204	CDD:226535
		C2H2 Zn finger	168..186	CDD:275368
		C2H2 Zn finger	473..493	CDD:275370	7/19 (37%)
		C2H2 Zn finger	501..522	CDD:275370	7/20 (35%)
Sry-delta	NP_524581.1	COG5048	<205..360	CDD:227381	26/109 (24%)
		C2H2 Zn finger	225..245	CDD:275368	7/19 (37%)
		C2H2 Zn finger	253..273	CDD:275368	7/20 (35%)
		C2H2 Zn finger	281..301	CDD:275368	3/19 (16%)
		C2H2 Zn finger	310..327	CDD:275370
		zf-C2H2	337..359	CDD:278523
		C2H2 Zn finger	339..359	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45455477
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.930