DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12219 and CG17803

DIOPT Version :9

Sequence 1:NP_572312.1 Gene:CG12219 / 31572 FlyBaseID:FBgn0043796 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster


Alignment Length:592 Identity:100/592 - (16%)
Similarity:165/592 - (27%) Gaps:263/592 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LDEQSAVLLFDGAGGASAPAPDDEDDG--KAMPESYLVQLISIHLYLCLSRDDAISTCICTECCS 72
            |::.|:.||.|..|..      ||||.  .|.|..:           .||.|             
  Fly   196 LEDFSSELLPDSEGVL------DEDDFPLDAEPTQF-----------SLSED------------- 230

  Fly    73 QLESFHNFWKLVELKQTTLCSQFLAI-DC----DVNWSEDGSET--------------------Q 112
            :|:...:..|...|:|...|::.::| .|    ::...:.|::.                    .
  Fly   231 ELDLDRDTEKDFALEQNKSCNEIISIRKCKTKEEIGKVDHGAKVYKVVLGEYNSLKETAPKYSLS 295

  Fly   113 LDAQPQLLLEPAEEPKVVTPTTANK---FPCMFCEKSFKMRRYLEEHIATHTGDRPIACPYCEMA 174
            |..:|||.:.|.|:.:........|   :.|..|..:|:.|..|:.|:..|...:...||.|...
  Fly   296 LPKKPQLRVSPEEKNRRRRERIQAKPLNYVCDKCGHTFRQRSQLQMHLLRHNRAKNFECPECPKK 360

  Fly   175 FRCRSNMYT---HVKSKHTTQWLKAREERDAAKSNQNHTTPEETAPAVLVPVPAPAPALASAPAS 236
            |   .::||   ||::.|..:                |            |.|.           
  Fly   361 F---YDLYTRNIHVRALHKGE----------------H------------PFPC----------- 383

  Fly   237 SASPGNTVNPAATATPASSATPTTNLAAAPLPSPPTVQQLPLSVIKSQPSEAMNLTITKTPPSGS 301
                 |..|.:..                                                    
  Fly   384 -----NHCNESFA---------------------------------------------------- 391

  Fly   302 RGSRNRSSRRKTHSPKKVQHTEGSDVSDEDSPQKRLKENELILANYNAVAAAVVAAASLTGNPPG 366
                |.|||   |..::..|..|:.:      :.|:|..|                         
  Fly   392 ----NASSR---HRHERDVHGAGNRI------RTRVKSKE------------------------- 418

  Fly   367 QPDSLQQRLCASLLQQQHQEQLFAVMSATAAAAAAVGTSSATTTTTTTTGTMMAHPYGNHPPSET 431
              :...:..|                            :..|.:.|:..|.::...:.|      
  Fly   419 --EGSSRHYC----------------------------TQCTKSYTSKKGLVLHMNFHN------ 447

  Fly   432 DKRPAAPLQAVI----HAAPVSIICPNCGELPGQNHRCL-SKPKYACDVCGKSFKMKRYLEEHFA 491
               .:.|.|..|    .|.|.::          :.|:.| .|....||:|.|.|.::..|.:|..
  Fly   448 ---GSRPFQCKICQMKFADPSAM----------KRHQALHDKFPIRCDICLKGFLLRSQLTKHQD 499

  Fly   492 THTGVKLHTCAFCPTEFRSKSNMYHHTK------RKHKAEWERSRATRSAAKAGVQEQM--QHTN 548
            .|||:..|.|..|...:|.:.|:..|..      ...||..|.....:.|.| .:.::|  :...
  Fly   500 VHTGMHPHRCEICDVHYRHRYNLNKHKNTDLHRDNMQKAIKEEVNGLQQAFK-DIDKEMDFESQT 563

  Fly   549 PSQAQAQ 555
            |.|..||
  Fly   564 PMQPNAQ 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12219NP_572312.1 zf-AD 2..94 CDD:285071 20/85 (24%)
C2H2 Zn finger 140..160 CDD:275368 6/19 (32%)
COG4049 149..204 CDD:226535 13/57 (23%)
C2H2 Zn finger 168..186 CDD:275368 7/20 (35%)
C2H2 Zn finger 473..493 CDD:275370 7/19 (37%)
C2H2 Zn finger 501..522 CDD:275370 5/26 (19%)
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871
COG5048 <323..528 CDD:227381 60/390 (15%)
zf-C2H2 324..346 CDD:278523 6/21 (29%)
C2H2 Zn finger 326..346 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..375 CDD:275368 8/23 (35%)
C2H2 Zn finger 383..401 CDD:275368 7/92 (8%)
C2H2 Zn finger 426..446 CDD:275368 4/47 (9%)
C2H2 Zn finger 454..474 CDD:275368 4/29 (14%)
C2H2 Zn finger 481..501 CDD:275368 7/19 (37%)
C2H2 Zn finger 509..528 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455470
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.