DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12219 and CG6791

DIOPT Version :9

Sequence 1:NP_572312.1 Gene:CG12219 / 31572 FlyBaseID:FBgn0043796 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster


Alignment Length:623 Identity:119/623 - (19%)
Similarity:175/623 - (28%) Gaps:231/623 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LCSQFL-------AIDCDVN--WSED-----------G-SETQLDAQPQLLLEPAEEPKVVTPTT 134
            ||..::       ..|||.:  ||:.           | :...:|.|.|.|    |..|:|||.|
  Fly   345 LCEDYIHYMCPDCGTDCDTHAQWSQHIEFVHDYVSRRGLNFRSVDMQMQCL----ECKKIVTPNT 405

  Fly   135 -----ANKFP---------CMFCEKSFK-----MRRYLEEH---------IATHTGDRPIA---- 167
                 |:||.         |..|.|.:.     :|..|::|         .....||.|.|    
  Fly   406 IKSLRAHKFSHLSQPEWLRCKLCYKGYTDHQEIIRHLLQQHHMDTLMSEDAEEEDGDAPSAIEDE 470

  Fly   168 ---------------------------------------------CPYCEMAFRCRSNMYTHVKS 187
                                                         ||.|...|..:.:..|||..
  Fly   471 CDGDNGNGEGNGAPLDEDSPYFEDAPRRGGRISSDDIFEPHIDYLCPQCGKEFIEKKHWRTHVVM 535

  Fly   188 KHTT--------QWLKARE----ERDAAKSN-------QNHTTPEETAPAVLVPVPAPAPA-LAS 232
            .|:.        :.:..|:    |.|...:|       |.|.         :..:|..|.| ...
  Fly   536 AHSMNDLSKLNFEMINERQLKCTECDKIITNAYGIQNAQQHR---------ITHLPFKAYARCRK 591

  Fly   233 APASSASPGNTVNPAATATPASSATPTTNLAAAPLPSPPTVQQLPLSVIKSQPSEAMNLTITKTP 297
            ...|.......|...||..........:....||:.:|   .:.|...|.:..:|...:......
  Fly   592 CHKSYTDRKGLVKHLATHHRVGWPRKLSGGCPAPILTP---AKQPRKQIVTVANETYEIIYLDDV 653

  Fly   298 PSGSRGSRNRSSRRKTHSPKKVQHTEGSDVSDEDSPQKRLKENELILANYNAVAAAVVAAASLTG 362
            ..|                       |.:..::...|.:.:|:|.           .:|....:.
  Fly   654 DQG-----------------------GMEEDNDFGEQMQAEEDEY-----------PIAPPPPSP 684

  Fly   363 NPPGQPDSL---QQRLCASLLQQQHQEQLFAVMSATAAAAAAVGTSSATTTTTTTTGTMMAHPYG 424
            .||.||.:.   |:..|.      |...|||..     ||..|..|......|...        .
  Fly   685 PPPPQPTTQGNHQRYKCV------HCGTLFATQ-----AAVRVHISEKRCRKTVVR--------R 730

  Fly   425 NHPPSETDKRPAAPL--QAVIHAAPVSIICPNCG-ELPGQ-------------------NHRCLS 467
            ...|..:...|:.|.  |..|      .:||:|| |...|                   |.|.|.
  Fly   731 RRQPVMSSADPSVPTVEQNYI------FLCPSCGFEYKTQFEWRRHINEVHNFDKRQYLNMRQLD 789

  Fly   468 KPKYACD-----VCGKSFKMKRYLEEHFATHTGVKLH-TCAFCPTEFRSKSNMYHHTKRKHKAEW 526
            |.:|.|.     ||....|   .|::|...|...:|: .|..|.|.:..|.|:..|.:.:|.. :
  Fly   790 KYRYQCTQCKDIVCNSKLK---GLQDHHFRHLPYRLYLKCLICGTCYNHKPNIAAHLRARHSI-F 850

  Fly   527 ER---SRATRSAAKAGVQEQMQHTNPSQAQAQPGPAAA 561
            :|   :..|:.....|..:.....||......|.||.|
  Fly   851 DRETPTMITKPKQVLGRYKDNSRENPKLPSPPPAPALA 888

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12219NP_572312.1 zf-AD 2..94 CDD:285071 2/2 (100%)
C2H2 Zn finger 140..160 CDD:275368 6/33 (18%)
COG4049 149..204 CDD:226535 18/124 (15%)
C2H2 Zn finger 168..186 CDD:275368 6/17 (35%)
C2H2 Zn finger 473..493 CDD:275370 6/24 (25%)
C2H2 Zn finger 501..522 CDD:275370 6/20 (30%)
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368
C2H2 Zn finger 208..230 CDD:275368
C2H2 Zn finger 235..256 CDD:275368
C2H2 Zn finger 516..532 CDD:275368 4/15 (27%)
C2H2 Zn finger 557..580 CDD:275368 5/31 (16%)
C2H2 Zn finger 589..609 CDD:275368 3/19 (16%)
COG5236 <939..>1096 CDD:227561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455510
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.