DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12219 and CG12942

DIOPT Version :9

Sequence 1:NP_572312.1 Gene:CG12219 / 31572 FlyBaseID:FBgn0043796 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_610628.2 Gene:CG12942 / 36158 FlyBaseID:FBgn0033569 Length:686 Species:Drosophila melanogaster


Alignment Length:546 Identity:104/546 - (19%)
Similarity:171/546 - (31%) Gaps:154/546 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ICTECCSQLESFHNFWKLVELKQTTLCSQFLAIDCDVNWSEDGSETQLDAQPQLLLEPAEEPKVV 130
            ||..||..||...:|   ||:.                 .|...:.|.:|:...|..|..|.|..
  Fly    74 ICVRCCRALEVAMHF---VEMA-----------------LESNLKLQAEAKSVKLPSPTGELKRK 118

  Fly   131 TPTTA---NKFPCMFCEKSFKMRRYLEEHIATHTGDRPIACPYCEMAFRCRSNMYTHVKS----- 187
            .....   |:|...|.:........:||::....|.:   .|..::  ...|:..|..|.     
  Fly   119 ASNETIPWNQFSQEFEQFVEGYEGPIEENVLYMRGTK---VPRLDV--DASSSSETAPKEDEVIL 178

  Fly   188 ---KHTTQWLKAREERDAAKSNQNHTTPEETAPAVLVPVPAPAPALASAPASSASPGNTVNPAAT 249
               |:.|..|:..:|.|.:.:..|.|..|                      :|.:||.:|...:.
  Fly   179 FDVKYDTNDLEEEDENDGSDAKNNETFFE----------------------NSITPGESVMVVSV 221

  Fly   250 ATPASSATPTTNLAAAPLPSPPTVQQLPLSVIKSQPSEAMNLTITKTPPSGSRGSRNRSSRRKTH 314
            |..|.......|....  ....|.::..|.      ..|:.:|:.....|              .
  Fly   222 AEKAVENNNNYNFNNK--NGDVTDEECDLI------QRALEMTLNDDGCS--------------Q 264

  Fly   315 SPKKVQHTEGSDVSDEDSPQKRLKENELILANYNAVAAAVVAAASLTGNPPGQPDSLQQRLCASL 379
            |||           :|.|.:.:||.|.:.::  :.:...:...:|.|||.|    .|:..:|   
  Fly   265 SPK-----------NEASNETQLKSNGIEVS--SPLFIKLATTSSTTGNIP----ILKCNIC--- 309

  Fly   380 LQQQH--QEQL----FAVMSATAAAAAAVGTSS--------ATTTTTTTTGTMMAHPYGNH---- 426
             |..|  .|||    .::...:......:|.:.        ..:..|.....|..|...:|    
  Fly   310 -QYTHTDAEQLKIHYKSIHKISMMEDDIIGLNKNQNFKCRPCNSYETKDRSEMQKHLIDHHKIDG 373

  Fly   427 ------------PPSE---TDKRPAAPLQAVIHAAPVSI--------ICPNCGELPGQ-----NH 463
                        |..:   .|:|.|......:| .||.|        .|..|.::..|     :|
  Fly   374 DFEMYCYMQANCPACDRIFKDQRSARKHYTRVH-TPVQIAVSPTESYACTACDKVFNQKASLHSH 437

  Fly   464 R--CLSKPKYACDVCGKSFKMKRYLEEHF-ATHTGVKLHTCAFCPTEFRSKSNMYHHTKRKHKAE 525
            :  |..|....|..|.:.|...|..|.|. ..|....:|.|..|...|:|...:..|.||..:..
  Fly   438 QRFCQVKDVVHCSFCDQQFNSMRKYELHLQQLHAVETVHECEICRRSFKSAETLTMHRKRHSERH 502

  Fly   526 WERSRATR---SAAKAGVQEQMQHTN 548
            ::..:.:.   ::|:..|..:..|.|
  Fly   503 YQCGKCSLNYVNSAELRVHYERAHVN 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12219NP_572312.1 zf-AD 2..94 CDD:285071 9/27 (33%)
C2H2 Zn finger 140..160 CDD:275368 3/19 (16%)
COG4049 149..204 CDD:226535 12/62 (19%)
C2H2 Zn finger 168..186 CDD:275368 3/17 (18%)
C2H2 Zn finger 473..493 CDD:275370 6/20 (30%)
C2H2 Zn finger 501..522 CDD:275370 7/20 (35%)
CG12942NP_610628.2 zf-AD 22..101 CDD:285071 10/46 (22%)
C2H2 Zn finger 385..406 CDD:275368 4/20 (20%)
C2H2 Zn finger 421..470 CDD:275368 12/48 (25%)
C2H2 Zn finger 449..466 CDD:275371 5/16 (31%)
C2H2 Zn finger 478..498 CDD:275368 6/19 (32%)
C2H2 Zn finger 505..526 CDD:275368 2/20 (10%)
C2H2 Zn finger 534..555 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440050
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.