DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12219 and CG30020

DIOPT Version :9

Sequence 1:NP_572312.1 Gene:CG12219 / 31572 FlyBaseID:FBgn0043796 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_610627.2 Gene:CG30020 / 36156 FlyBaseID:FBgn0050020 Length:1309 Species:Drosophila melanogaster


Alignment Length:478 Identity:92/478 - (19%)
Similarity:153/478 - (32%) Gaps:124/478 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 CMFCEKSFKMRRYLEEHIATHTGDRPIACPYCEMAFRCRSNMYTHVKSKHTTQWLKAREERDAAK 204
            |::|.|.|..:...|.|:..|.|..|..|..|...:..:..:..|.|:.|     |....||..:
  Fly   730 CIYCNKKFTSQYKFENHMFVHRGLAPYRCELCTNLYNMKRLLIKHYKTVH-----KRMPTRDMVQ 789

  Fly   205 SNQNHTTPEETAPAVLVP--VPAPAPALASAPASSASPG---------NTVNPAATATPASSATP 258
            :..:..:...|....|.|  :..|....|..|....|..         :.:|...    :..|..
  Fly   790 AKGDKVSVARTNIEKLYPGRIKNPMLMCAKCPFECESDSEMRKHLNAHHGINDGV----SEHANE 850

  Fly   259 TTNLAAAPLPSPPTVQQLPLSVIKSQPSEAMNLTIT----KTPPSGSRGSRNRSSRRKTHS-PKK 318
            ...:...|...|..::........|:..:..:|..|    :||..|...:...::...|.| |..
  Fly   851 VFIIRKLPFECPRCIRSFAAKTTLSRHLQRSHLVDTIIEMQTPHCGEAITTTMATSSSTISEPVN 915

  Fly   319 VQHTEGSDVSDEDSPQKRLKENELILANYNAVAAAVVAAASLT-------GNPPG---------- 366
            ....:|             :.||::..:        |.|..:|       ||..|          
  Fly   916 SVTVDG-------------QHNEMMQTD--------VGAEKMTEALGNGDGNEEGGTDDGTGVKA 959

  Fly   367 QPDSLQQRLCASLLQQQHQEQLFAVMSATAAAAAAVGTS--SATTTTTTTTGTMMAHP------- 422
            :|...::.|....|.........|:.:|.:|||||..||  |...||.:::.|:...|       
  Fly   960 EPAVPEEELDPVTLDAATAVTTTAIAAAISAAAAATATSLESPVATTASSSTTLFPTPTPFDFDY 1024

  Fly   423 -------------------------YGNHPPSETDK---------RPAAPLQ--AVIHAAPVSII 451
                                     ..:.|.:|:.|         .||..|:  :.:|.:.:. |
  Fly  1025 DIMRDEAQQSSPNIHDVSKALSDNASSSCPINESYKLLSTTALETSPAKGLRSNSRLHRSSIH-I 1088

  Fly   452 CPNCG--------------ELPGQNHRCLSKPKYACDVCGKSFKMKRYLEEHFATHTGVKLHTCA 502
            |..|.              ||.....|.....::.|.:|..|::....|:.|...|:..| ..|.
  Fly  1089 CKLCNQTFDELGKLVKHEMELHSNTERSRWGYQHKCAICNTSYRTLTLLKFHMKRHSNRK-SQCK 1152

  Fly   503 FCPTEFRSKSNMYHHTKRKHKAE 525
            .||..|.:.:.:..|||.||..:
  Fly  1153 LCPKSFVTIAELERHTKAKHSKD 1175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12219NP_572312.1 zf-AD 2..94 CDD:285071
C2H2 Zn finger 140..160 CDD:275368 6/19 (32%)
COG4049 149..204 CDD:226535 13/54 (24%)
C2H2 Zn finger 168..186 CDD:275368 3/17 (18%)
C2H2 Zn finger 473..493 CDD:275370 5/19 (26%)
C2H2 Zn finger 501..522 CDD:275370 7/20 (35%)
CG30020NP_610627.2 zf-AD 25..106 CDD:285071
C2H2 Zn finger 369..389 CDD:275368
C2H2 Zn finger 397..418 CDD:275368
C2H2 Zn finger 442..460 CDD:275368
C2H2 Zn finger 730..750 CDD:275368 6/19 (32%)
C2H2 Zn finger 758..777 CDD:275368 3/18 (17%)
C2H2 Zn finger 1089..1110 CDD:275368 3/20 (15%)
C2H2 Zn finger 1124..1144 CDD:275368 5/19 (26%)
C2H2 Zn finger 1151..1172 CDD:275368 7/20 (35%)
C2H2 Zn finger 1180..1203 CDD:275368
C2H2 Zn finger 1210..1230 CDD:275368
C2H2 Zn finger 1238..1254 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439991
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.