DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12219 and CG11695

DIOPT Version :9

Sequence 1:NP_572312.1 Gene:CG12219 / 31572 FlyBaseID:FBgn0043796 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster


Alignment Length:657 Identity:140/657 - (21%)
Similarity:196/657 - (29%) Gaps:249/657 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MICRLCLNALDEQSAVLLFDGAGGASAPAPDDEDDGKAMPESYLVQLISIHLYLCLSRDDAISTC 65
            |||||||:  |.:.:|.:||.......|.|           |.|.:||..||.|.|..:|.:|..
  Fly     1 MICRLCLD--DAEHSVPIFDQDDSGDQPVP-----------SNLAELIEKHLQLVLLPNDGVSKS 52

  Fly    66 ICTECCSQLESFHNFWKLVELKQTTLCSQFLAIDCDVNWSEDGSETQLDAQPQLLLEPAEEPKVV 130
            :||:|..||..|..|..:|..||..|  |.|.::   .:|||   ...|.:.|:|.||..:   |
  Fly    53 LCTQCWQQLADFEQFCAMVMKKQLGL--QQLKME---PFSED---EDADTKAQILCEPEID---V 106

  Fly   131 TPTTANKFPCMFCEKSFKMRRYLEEHIATHTGDRPIACPYCEMAFRCRSNMYTHVKSKHTTQWLK 195
            :|..|:...|                                                       
  Fly   107 SPAAADNEEC------------------------------------------------------- 116

  Fly   196 AREERDAAKSNQNHTTPEETAPAVLVPVPAPAPALASAPASSASPGNTVNPAATATPASSATPTT 260
                                                          |.::..|::...||:..||
  Fly   117 ----------------------------------------------NEIDGDASSNSRSSSIRTT 135

  Fly   261 NLAAAPLPSP-PTVQQLPLSVIKSQPSEAMNLTITKT----------------PPSGSRGSRNRS 308
            :|....|||| ....:||.:|...:.........|||                |.|.|..||...
  Fly   136 SLREMRLPSPIRRRMRLPRAVTAPKTQAVKAKARTKTHKAEADEDEDAEGEGDPESRSSNSREMD 200

  Fly   309 SRRKTHSPKKVQHTEGSDVSDEDSP----------------------QKRLKENELIL------- 344
            |....|...:.....|    ||..|                      |:|.|:..|.:       
  Fly   201 SYIALHGRLECCICGG----DEQFPNFAEMKRHFRNHHQSLGYVVCCQRRYKKRALYVDHLHMHN 261

  Fly   345 -ANY---NAVAAAVVAAAS-----LTGNPPGQP-----DSLQQRLCASLL--------QQQHQEQ 387
             .||   ...:..:|:..|     |..:|....     |...:|.....|        ||:..||
  Fly   262 DPNYFRCKICSKQLVSRISYDVHMLRFHPNKDDLSFACDQCSKRFSKQFLLTIHSRVHQQERNEQ 326

  Fly   388 -------------LFAVMSATAAAAAAVGTSSATTTTTTTTGTMMAHPYGNHPPSETDKRPAAPL 439
                         |...|..|...|.......:......|...::.|....|  .|..:.|....
  Fly   327 CKHCDRSFRTAVDLRLHMRRTHDPAFVPFICDSCGAKFKTKQNLLVHKRTVH--REGSQLPEVQC 389

  Fly   440 Q---------------AVIHAAPVSI---ICPNCGELPGQNHRCLSKPKY-------ACDVCGKS 479
            |               ..:|....|:   .|..||...|...:..:..:|       .|..|.|.
  Fly   390 QECQVWLSDENSLRKHMYMHLDAASLRQWKCEQCGLEKGSRAKLAAHIRYHHPKEYHKCTHCAKE 454

  Fly   480 FKMKRYLEEHFATHTGVKLHTCAFCPTEFRSKSNMYHHTKRKHKAEWERSRATRSAAKAGVQEQM 544
            ||..|.||||.|||||..|:.||||...|::..||:.|.::.|            ||:....:|.
  Fly   455 FKSSRSLEEHTATHTGQDLYECAFCERTFKNSGNMHKHRRQMH------------AAQVAALQQQ 507

  Fly   545 QHTNPSQ 551
            :...||:
  Fly   508 KKVPPSK 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12219NP_572312.1 zf-AD 2..94 CDD:285071 33/91 (36%)
C2H2 Zn finger 140..160 CDD:275368 1/19 (5%)
COG4049 149..204 CDD:226535 0/54 (0%)
C2H2 Zn finger 168..186 CDD:275368 0/17 (0%)
C2H2 Zn finger 473..493 CDD:275370 11/19 (58%)
C2H2 Zn finger 501..522 CDD:275370 8/20 (40%)
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 34/93 (37%)
C2H2 Zn finger 268..289 CDD:275368 3/20 (15%)
C2H2 Zn finger 299..319 CDD:275368 3/19 (16%)
C2H2 Zn finger 327..348 CDD:275368 2/20 (10%)
C2H2 Zn finger 357..376 CDD:275368 2/18 (11%)
C2H2 Zn finger 389..409 CDD:275368 1/19 (5%)
C2H2 Zn finger 420..440 CDD:275368 4/19 (21%)
C2H2 Zn finger 448..468 CDD:275368 11/19 (58%)
C2H2 Zn finger 476..494 CDD:275368 8/17 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455469
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000909
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.