DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12219 and CG3032

DIOPT Version :9

Sequence 1:NP_572312.1 Gene:CG12219 / 31572 FlyBaseID:FBgn0043796 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster


Alignment Length:561 Identity:101/561 - (18%)
Similarity:159/561 - (28%) Gaps:221/561 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ICRLCLNALDEQSAVLLFDGAGGASAPAPDDEDDGKAMPESYLVQLISIHLYLCLSRDDA----I 62
            :|..||..|:::              |...:....:......|.||::|:|...:...||    :
  Fly    13 LCCTCLLQLEKE--------------PLKTELQSDEIPISQELQQLLNINLSQDVENQDADQQWL 63

  Fly    63 STCICTECCSQLESFHNFWK--------LVE-LKQTTLCSQFLAIDCDVNWSEDGSETQLDA--- 115
            ...:|.||.|.:::|..|.:        |:| ||:......|..:       .||.|...::   
  Fly    64 PNELCLECRSAVQNFEKFRRKADECRKQLLEMLKKDPREPTFEVV-------YDGREEDQESLHG 121

  Fly   116 ----QPQLLLEPAEEPKVVTPT--------TANKFPCMFCEKSFKMRRYLEEHI-ATHTGD-RPI 166
                :|....:|.:||.:.:..        :.|...|..|.:||..:..|..|| ..|.|. ||.
  Fly   122 LEPPEPAPDPDPIDEPAIKSDKSPRKSFRGSRNTLKCSVCRRSFAHQITLAAHIRKVHEGSKRPF 186

  Fly   167 ACPYCEMAFRCRSNMYTHVKSKHTTQWLKAREERDAAKSNQNHTTPEETAPAVLVPVPAPAPALA 231
            .|..||.|:.....:|||::..|                                          
  Fly   187 QCDQCEKAYSFMGGLYTHIREVH------------------------------------------ 209

  Fly   232 SAPASSASPGNTVNPAATATPASSATPTTNLAAAPLPSPPTVQQLPLSVIKSQPSEAMNLTITKT 296
             ||.....|.:        .|......|:.:|.                                
  Fly   210 -APKERRHPCD--------QPGCERIYTSRIAM-------------------------------- 233

  Fly   297 PPSGSRGSRNRSSRRKTHSPKKVQHTEGSDVSDEDSPQKRLKENELILANYNAVAAAVVAAASLT 361
                      :..:|..|||:           |.|:.:|.:.|.  ..|::|             
  Fly   234 ----------QKHKRLKHSPR-----------DRDALKKFICEQ--CGASFN------------- 262

  Fly   362 GNPPGQPDSLQQRLCASLLQQQHQEQLFAVMSATAAAAAAVG--------TSSATTTTTTTTGTM 418
                 |..:|:..     |:.:|..:     ...||.....|        .....:..|....|:
  Fly   263 -----QSANLKYH-----LKTKHPTE-----DEVAAREGGAGERHFCDICQKEFHSRYTLKYHTL 312

  Fly   419 MAHPYGNHPPSETDKRPAAPLQAVIHAAPVSIICPNCGELPGQNHRCL------SKPKYACDVCG 477
            ..|......|.|                     |..||....:....|      |..|..|:.||
  Fly   313 QQHEVQEELPHE---------------------CQVCGRRMAKKFMLLQHMLMHSNDKLPCEHCG 356

  Fly   478 KSFKMKRYLEEHF-ATHTGVKLHTCAFCPTEFRSKSNMYHH 517
            :.|..:..||.|. |.|..:|...|..||..|.|:..:.||
  Fly   357 RRFARRFELEAHVRAVHLKLKPFPCHHCPESFASRKTLRHH 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12219NP_572312.1 zf-AD 2..94 CDD:285071 22/104 (21%)
C2H2 Zn finger 140..160 CDD:275368 7/20 (35%)
COG4049 149..204 CDD:226535 15/56 (27%)
C2H2 Zn finger 168..186 CDD:275368 7/17 (41%)
C2H2 Zn finger 473..493 CDD:275370 8/20 (40%)
C2H2 Zn finger 501..522 CDD:275370 7/17 (41%)
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071 19/95 (20%)
C2H2 Zn finger 158..179 CDD:275368 7/20 (35%)
C2H2 Zn finger 188..209 CDD:275368 7/20 (35%)
C2H2 Zn finger 218..239 CDD:275368 3/70 (4%)
C2H2 Zn finger 254..275 CDD:275368 6/45 (13%)
C2H2 Zn finger 294..315 CDD:275368 2/20 (10%)
C2H2 Zn finger 325..345 CDD:275368 4/19 (21%)
C2H2 Zn finger 352..373 CDD:275368 8/20 (40%)
C2H2 Zn finger 381..401 CDD:275368 7/17 (41%)
C2H2 Zn finger 409..429 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455476
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.