DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12219 and che-1

DIOPT Version :9

Sequence 1:NP_572312.1 Gene:CG12219 / 31572 FlyBaseID:FBgn0043796 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001076598.1 Gene:che-1 / 183847 WormBaseID:WBGene00000483 Length:273 Species:Caenorhabditis elegans


Alignment Length:82 Identity:28/82 - (34%)
Similarity:39/82 - (47%) Gaps:6/82 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 LDAQPQLLLEPAEEP----KVVTPTTANKFPCMFCEKSFKMRRYLEEHIATHTGDRPIACPYCEM 173
            :|..|.|.| |.:||    :.:..:|...|.|..|.|:|.....|..|...|||::|..||.|..
 Worm   138 MDPTPSLRL-PKKEPLPVQRPMARSTPKPFRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNR 201

  Fly   174 AFRCRSNMYTHVKSKHT 190
            .|...|::.|| :..||
 Worm   202 PFSQSSSLVTH-RRTHT 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12219NP_572312.1 zf-AD 2..94 CDD:285071
C2H2 Zn finger 140..160 CDD:275368 6/19 (32%)
COG4049 149..204 CDD:226535 15/42 (36%)
C2H2 Zn finger 168..186 CDD:275368 7/17 (41%)
C2H2 Zn finger 473..493 CDD:275370
C2H2 Zn finger 501..522 CDD:275370
che-1NP_001076598.1 zf-C2H2 166..188 CDD:278523 7/21 (33%)
C2H2 Zn finger 168..188 CDD:275368 6/19 (32%)
zf-H2C2_2 180..205 CDD:290200 10/24 (42%)
C2H2 Zn finger 196..216 CDD:275368 7/20 (35%)
zf-H2C2_2 208..232 CDD:290200 4/11 (36%)
C2H2 Zn finger 224..244 CDD:275368
zf-H2C2_2 237..261 CDD:290200
C2H2 Zn finger 252..272 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.