DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3815 and Aire

DIOPT Version :9

Sequence 1:NP_572311.1 Gene:CG3815 / 31571 FlyBaseID:FBgn0029861 Length:878 Species:Drosophila melanogaster
Sequence 2:XP_006256309.1 Gene:Aire / 294328 RGDID:1311139 Length:551 Species:Rattus norvegicus


Alignment Length:320 Identity:75/320 - (23%)
Similarity:105/320 - (32%) Gaps:110/320 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QDPNASLSIM----EQIKQLIRP-------PPNEDEKMMQRSTNTKHPYYRRPGRGH--NHDYCD 57
            :||:.:|...    ..:|.:||.       |..:::|:.|:......|......:.|  |.|.|.
  Rat   238 EDPSGNLKNKTRGGSSLKPVIRGKGTQVTIPGRDEQKVSQQCGVPPLPPLPNEPQVHQKNEDECA 302

  Fly    58 ACEEGGNLLCCDRCPSSFHLQCHDPPLSEEDIPSGQWLCHSCRMSKLSQPPASSSKASSVERVPS 122
            .|.:||.|:|||.||.:|||.|..|||.|  ||||.|.|..|...::.|..:...::..:|  ||
  Rat   303 VCHDGGELICCDGCPRAFHLACLSPPLQE--IPSGLWRCSCCLQGRIQQNLSQPEESRPLE--PS 363

  Fly   123 AGSGSRANTPSSGDLESIPLKIRNLRKRSNSERNSTEKLLAKMPMSIQRALDPNKKPTPLDDVIR 187
                  |.||.          :..||..|...|..:.:|                 |...|..:.
  Rat   364 ------AETPI----------LLGLRSASEKTRVLSREL-----------------PAGSDAAVT 395

  Fly   188 AATMMNPQQFSLPPELELHTQFPGNGKVQPVQQTHPPSGNGGNRRCAGNQRRNSKPFELDAQGLV 252
            .|.::.|.  |..|.||                   ||                        .|.
  Rat   396 YANLLAPP--STAPVLE-------------------PS------------------------ALC 415

  Fly   253 PLP------------AKTCFYCTRSCKRAPLISCDYCPLYFHQDCLDPPLTALPAGLWMC 300
            |||            :..|..|..|   ..::.|.:|...||..|..|.....|.....|
  Rat   416 PLPSAGAEGQPGPTLSARCGVCGDS---TDVLRCAHCAAAFHWRCHFPMAAVRPGTNLRC 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3815NP_572311.1 PHD1_PHF12 55..99 CDD:277008 24/43 (56%)
BAH 75..198 CDD:295389 31/122 (25%)
PHF12_MRG_bd 175..211 CDD:293342 8/35 (23%)
PHD2_PHF12_Rco1 259..303 CDD:277009 11/42 (26%)
FHA <732..>765 CDD:238017
AireXP_006256309.1 Sp100 17..103 CDD:281203
SAND 198..264 CDD:295351 6/25 (24%)
PHD1_AIRE 300..342 CDD:277014 24/43 (56%)
PHD2_AIRE 433..475 CDD:277015 11/43 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203363at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.