DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3815 and cph1

DIOPT Version :9

Sequence 1:NP_572311.1 Gene:CG3815 / 31571 FlyBaseID:FBgn0029861 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_593079.1 Gene:cph1 / 2542318 PomBaseID:SPAC16C9.05 Length:404 Species:Schizosaccharomyces pombe


Alignment Length:300 Identity:69/300 - (23%)
Similarity:102/300 - (34%) Gaps:108/300 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DQDPNASLSIMEQIKQLIRPPPNEDEKMMQRSTNTKH---------PYYRRPGRG--HNHDYCDA 58
            |::.:.|..:.:|........||:......|.::.|.         |..||..:.  .|.|||.|
pombe    58 DKEMDISSPVKKQKASYSNKSPNKAPIQKSRGSSLKSHLETESQQTPVKRRRRKATIRNVDYCSA 122

  Fly    59 CEEGGNLLCCDRCPSSFHLQCHDPPLSEEDIPSGQWLCHSCRMSKLSQPPASSSKASSVERVPSA 123
            |...|..:||:.||.||||.|.:|||:.|:||.|.|.|.:|.: |...||               
pombe   123 CGGRGLFICCEGCPCSFHLSCLEPPLTPENIPEGSWFCVTCSI-KSHHPP--------------- 171

  Fly   124 GSGSRANTPSSGDLESIPLKIRNLRKRSNSERNSTEKLLAKMPMSIQRALDPNKKPTPLDDVIRA 188
                                                    |.|:||.         :.|.|.|.:
pombe   172 ----------------------------------------KHPLSIW---------SQLYDWIDS 187

  Fly   189 ATMMNPQQFSLPPELELHTQFPGNGKVQPVQQTHPPSGNGGNRRCAGNQRRNSKPFELDAQGLVP 253
               .||.|:.||.:| :| .|.|..:          ...|..:...|         |:|......
pombe   188 ---QNPSQYRLPDDL-VH-YFHGISR----------GDTGAYKETEG---------EMDTDEFSA 228

  Fly   254 LPAKT-------CFYCTRSCKRAPLI-SCDYCPLYFHQDC 285
            ||..:       |.||::....|..: .|..|..::|::|
pombe   229 LPTGSSITNLAYCGYCSKPSMGACWVYGCQLCDTFYHKNC 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3815NP_572311.1 PHD1_PHF12 55..99 CDD:277008 23/43 (53%)
BAH 75..198 CDD:295389 27/122 (22%)
PHF12_MRG_bd 175..211 CDD:293342 11/35 (31%)
PHD2_PHF12_Rco1 259..303 CDD:277009 7/27 (26%)
FHA <732..>765 CDD:238017
cph1NP_593079.1 PHD1_Rco1 119..163 CDD:277010 23/43 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4299
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003315
OrthoInspector 1 1.000 - - otm47342
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1691
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.