DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lingo1 and Fili

DIOPT Version :9

Sequence 1:NP_001094192.1 Gene:Lingo1 / 315691 RGDID:1308668 Length:620 Species:Rattus norvegicus
Sequence 2:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster


Alignment Length:409 Identity:125/409 - (30%)
Similarity:184/409 - (44%) Gaps:50/409 - (12%)


- Green bases have known domain annotations that are detailed below.


  Rat    25 PILLLVLGS--VLSGSATG-CPPRCEC---SAQDRAVLCHRKRFVAVPEGIPTETRLLDLGKNRI 83
            |:|||:|.:  :|....|. ||.:|:|   .|..|| ||.......||..:..||:.::|..|||
  Fly    22 PVLLLLLLTLVILPPETTAFCPSKCQCLGGEANSRA-LCVDAALEDVPIQLNPETKYINLTVNRI 85

  Rat    84 KTLNQDEFASFP---HLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKLIPLGVFTGLSNL 145
            :||   || |.|   .||.|:|::||:..:....|.....||||.|..|.:..:....|.||:||
  Fly    86 RTL---EF-SLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTNL 146

  Rat   146 TKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEA 210
            ..||:|.|:|..:......||.:|..|::.:|::|.:....|.|:|:||.|......|..:|...
  Fly   147 LLLDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVPASN 211

  Rat   211 LSHLHGLIVLRLRHLNINAIRDYSFKRLYRLKVLEISHWPYLDTMTPNCLYGL-NLTSLSITHCN 274
            |.|||.|..|.:....:..:|:.||:.|..|..|.: ....:..:..:...|| :|..|.::..|
  Fly   212 LWHLHALKSLDMSLNLVEFVRNDSFEGLKELLALSV-QGNVMSELDLSAFEGLISLKHLDLSDNN 275

  Rat   275 LTAVPYLAVRHLVYLRFLNLSYNPIGTIEGSMLHELLRLQEIQLV-------------------- 319
            ||.||...:..|..|.:|||..|....:.......|..|:|:.|.                    
  Fly   276 LTMVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVDNTHLQ 340

  Rat   320 ------GGQLAVVEPYAFRGLNYLRVLNVSGNQLTTLEESAFHSVGNLETLILDSNPLACDCRLL 378
                  ..||:.:....|:|...:..:.:..|.|.||..:.| .|..|:.|.|..|||.|:|.||
  Fly   341 TLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQF-PVDQLQKLYLGDNPLQCNCSLL 404

  Rat   379 WVFRRRWRL---NFNRQQP 394
            |:    |||   ||....|
  Fly   405 WL----WRLVTGNFEGVDP 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lingo1NP_001094192.1 LRRNT 41..75 CDD:214470 13/37 (35%)
LRR <66..371 CDD:227223 95/334 (28%)
leucine-rich repeat 73..96 CDD:275380 11/25 (44%)
leucine-rich repeat 97..120 CDD:275380 7/22 (32%)
LRR_8 120..179 CDD:404697 21/58 (36%)
leucine-rich repeat 121..144 CDD:275380 9/22 (41%)
leucine-rich repeat 145..192 CDD:275380 14/46 (30%)
leucine-rich repeat 193..216 CDD:275380 8/22 (36%)
leucine-rich repeat 217..264 CDD:275380 10/47 (21%)
leucine-rich repeat 265..288 CDD:275380 8/22 (36%)
leucine-rich repeat 289..312 CDD:275380 6/22 (27%)
leucine-rich repeat 313..336 CDD:275380 7/48 (15%)
leucine-rich repeat 337..357 CDD:275380 5/19 (26%)
PCC 341..>421 CDD:188093 23/57 (40%)
IgI_Lingo-1 423..514 CDD:409561
Ig strand B 442..446 CDD:409561
Ig strand C 455..459 CDD:409561
Ig strand E 480..484 CDD:409561
Ig strand F 494..499 CDD:409561
Ig strand G 507..510 CDD:409561
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 11/25 (44%)
leucine-rich repeat 98..121 CDD:275380 7/22 (32%)
LRR_8 120..180 CDD:404697 21/59 (36%)
leucine-rich repeat 122..145 CDD:275380 9/22 (41%)
leucine-rich repeat 146..169 CDD:275380 8/22 (36%)
LRR <161..>354 CDD:227223 47/193 (24%)
leucine-rich repeat 170..193 CDD:275380 6/22 (27%)
leucine-rich repeat 194..217 CDD:275380 8/22 (36%)
leucine-rich repeat 218..265 CDD:275380 10/47 (21%)
leucine-rich repeat 266..289 CDD:275380 8/22 (36%)
leucine-rich repeat 290..313 CDD:275380 6/22 (27%)
leucine-rich repeat 314..338 CDD:275380 3/23 (13%)
LRR_8 337..397 CDD:404697 14/60 (23%)
leucine-rich repeat 339..360 CDD:275380 3/20 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BH3X
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8997
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1280
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.