DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg20a and Dsp1

DIOPT Version :9

Sequence 1:XP_006243179.1 Gene:Hmg20a / 315689 RGDID:1564760 Length:350 Species:Rattus norvegicus
Sequence 2:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster


Alignment Length:147 Identity:51/147 - (34%)
Similarity:78/147 - (53%) Gaps:10/147 - (6%)


- Green bases have known domain annotations that are detailed below.


  Rat    72 AEGSEQRPEDEQRS----KRGGWSKGRKRKKPLRDSNAPKSPLTGYVRFMNERREQLRAKRPEVP 132
            ||..:||.|.|.::    |.....:|:|||: ::|.||||..|:.:..|.|:.|.:::|..||..
  Fly   238 AEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQ-IKDPNAPKRSLSAFFWFCNDERNKVKALNPEFG 301

  Rat   133 FPEITRMLGNEWSKLPPEEKQRYLDEADRDKERYMKELEQYQKTEAYKVFS----RKTQDRQKGK 193
            ..:|.:.||.:||.:.||.||:|...|:|||.||.:|:.:| ||......|    :.:...|..|
  Fly   302 VGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEY-KTSGKIAMSAPSMQASMQAQAQK 365

  Rat   194 SHRQDAARQATHDHEKE 210
            :....||.|..|...:|
  Fly   366 AALLAAAAQQQHQQLEE 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg20aXP_006243179.1 HMGB-UBF_HMG-box 106..171 CDD:238686 26/64 (41%)
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 6/13 (46%)
HMGB-UBF_HMG-box 275..339 CDD:238686 25/63 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.