DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt4 and AT5G20000

DIOPT Version :9

Sequence 1:NP_572308.3 Gene:Rpt4 / 31567 FlyBaseID:FBgn0028685 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_197500.1 Gene:AT5G20000 / 832122 AraportID:AT5G20000 Length:419 Species:Arabidopsis thaliana


Alignment Length:401 Identity:189/401 - (47%)
Similarity:255/401 - (63%) Gaps:22/401 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TPMPDNLRVKALSE-----YRKKLLEH-KEIE----------GRLKEKREEIKDLTKLYDKSEND 54
            |.|.:...||..:.     ..|..|:| .|::          .||:.:|.|:....::.   ..:
plant    13 TAMEETCNVKGAAAKQGEGLNKYYLQHLDELQRLQREKSYNLNRLEAQRNELNSRVRML---REE 74

  Fly    55 LKALQSVGQIVGEVLKQLTEDKFIVKATNGPRYVVGCRRQLDKAKLKSGTRVALDMTTLTIMRYL 119
            |:.||..|..||||:|.:.::|.:||.....:|||...:.:|..||...|||||...:..:...|
plant    75 LQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKLTPSTRVALRNDSYVLHLVL 139

  Fly   120 PREVDPLVYNMSHEDPGDVTYSAIGGLTDQIRELREVIELPLLNPELFLRVGITPPKGCLLYGPP 184
            |.:|||||..|..|...|.||..||||..||:|::||||||:.:||||..:||..|||.||||||
plant   140 PSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPP 204

  Fly   185 GTGKTLLARAVASQLDANFLKVVSSAIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGR 249
            ||||||||||||...|..|::|..|.:|.|||||.:|::||:|..||:|.|.||||||||:||..
plant   205 GTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSA 269

  Fly   250 RFSEGT-SADREIQRTLMELLNQMDGFDSLGQVKMIMATNRPDTLDPALLRPGRLDRKIEIPLPN 313
            |...|: :.|.|:|||::|||||:|||::..::|::|||||.|.||.|||||||:|||||.|.||
plant   270 RMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPN 334

  Fly   314 EQARLEILKIHALKIAKHGEIDYEAIVKLSDNFNGADLRNVCTEAGLFAIRAEREYVIQEDFMKA 378
            |::|.:|||||:.|:.....||.:.|.:..:..:||:|:.||||||:||:|..|.:|.||||..|
plant   335 EESRFDILKIHSRKMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMA 399

  Fly   379 VRKV--SDNKK 387
            |.||  .|.:|
plant   400 VAKVMKKDTEK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt4NP_572308.3 RPT1 13..395 CDD:224143 187/394 (47%)
AAA 179..311 CDD:278434 82/132 (62%)
AT5G20000NP_197500.1 RPT1 34..417 CDD:224143 185/380 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D571919at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.