DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt4 and RPT5A

DIOPT Version :9

Sequence 1:NP_572308.3 Gene:Rpt4 / 31567 FlyBaseID:FBgn0028685 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_187204.1 Gene:RPT5A / 819718 AraportID:AT3G05530 Length:424 Species:Arabidopsis thaliana


Alignment Length:412 Identity:177/412 - (42%)
Similarity:249/412 - (60%) Gaps:39/412 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ATPMPDNLRVKALSEYRKKL-LEHKEIEGRLKEKREEIKDLTKLYDKSENDLKALQSVGQIVGEV 68
            ||.:.|| .::.|.|..::. ||....:.::||.:|:|| |.|       .|..|  ||.|| |:
plant    28 ATRLLDN-EIRILKEDAQRTNLECDSYKEKIKENQEKIK-LNK-------QLPYL--VGNIV-EI 80

  Fly    69 LKQLTED-----------------KFIVKATNGPRY----VVGCRRQLDKAKLKSGTRVALDMTT 112
            |:...||                 |.:|..|:..:.    |||.   :|...||.|..|.::..:
plant    81 LEMNPEDDAEEDGANIDLDSQRKGKCVVLKTSTRQTIFLPVVGL---VDPDSLKPGDLVGVNKDS 142

  Fly   113 LTIMRYLPREVDPLVYNMSHEDPGDVTYSAIGGLTDQIRELREVIELPLLNPELFLRVGITPPKG 177
            ..|:..||.|.|..|..|..::.....|:.||||..||:||.|.|.||:.:.|.|.::|:.||||
plant   143 YLILDTLPSEYDSRVKAMEVDEKPTEDYNDIGGLEKQIQELVEAIVLPMTHKERFEKLGVRPPKG 207

  Fly   178 CLLYGPPGTGKTLLARAVASQLDANFLKVVSSAIVDKYIGESARLIREMFNYARDHQPCIIFMDE 242
            .||||||||||||:|||.|:|.:|.|||:....:|..:||:.|:|:|:.|..|::..|||||:||
plant   208 VLLYGPPGTGKTLMARACAAQTNATFLKLAGPQLVQMFIGDGAKLVRDAFQLAKEKAPCIIFIDE 272

  Fly   243 IDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDSLGQVKMIMATNRPDTLDPALLRPGRLDRKI 307
            |||||.:||....|.|||:|||::|||||:|||.|..::|:|.||||.|.|||||:|.|||||||
plant   273 IDAIGTKRFDSEVSGDREVQRTMLELLNQLDGFSSDERIKVIAATNRADILDPALMRSGRLDRKI 337

  Fly   308 EIPLPNEQARLEILKIHALKIAKHGEIDYEAIVKLSDNFNGADLRNVCTEAGLFAIRAEREYVIQ 372
            |.|.|.|:||..||:||:.|:..|.::::|.:.:.:|:||||.|:.||.|||:.|:|.:...|..
plant   338 EFPHPTEEARARILQIHSRKMNVHPDVNFEELARSTDDFNGAQLKAVCVEAGMLALRRDATEVNH 402

  Fly   373 EDFMKAVRKVSDNKKLESKLDY 394
            |||.:.:.:|...||  :.|:|
plant   403 EDFNEGIIQVQAKKK--ASLNY 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt4NP_572308.3 RPT1 13..395 CDD:224143 173/404 (43%)
AAA 179..311 CDD:278434 80/131 (61%)
RPT5ANP_187204.1 RPT1 29..417 CDD:224143 172/402 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1222
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D571919at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.