DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt4 and PSMC5

DIOPT Version :9

Sequence 1:NP_572308.3 Gene:Rpt4 / 31567 FlyBaseID:FBgn0028685 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_024306608.1 Gene:PSMC5 / 5705 HGNCID:9552 Length:433 Species:Homo sapiens


Alignment Length:384 Identity:182/384 - (47%)
Similarity:242/384 - (63%) Gaps:32/384 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RLKEKREEIKDLTKLYDKSENDLKALQSVGQIVGEVLKQLTEDKFIVKATNGPRYVVGCRRQLD- 96
            ||:.:|.|:....:|.   ..:|:.||..|..||||::.:.:.|.:||.....::||...:.:| 
Human    44 RLQAQRNELNAKVRLL---REELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDI 105

  Fly    97 --------------------KAKLKSGT------RVALDMTTLTIMRYLPREVDPLVYNMSHEDP 135
                                ..||...|      ||||...:.|:.:.||.:|||||..|..|..
Human   106 NDVSVAGEVVVVVGSALTVPLLKLAPFTQVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKV 170

  Fly   136 GDVTYSAIGGLTDQIRELREVIELPLLNPELFLRVGITPPKGCLLYGPPGTGKTLLARAVASQLD 200
            .|.||..||||..||:|::||||||:.:||||..:||..|||.||||||||||||||||||...|
Human   171 PDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTD 235

  Fly   201 ANFLKVVSSAIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTL 265
            ..|::|..|.:|.|:|||.||::||:|..||:|.|.||||||||:||..|...|:..|.|:|||:
Human   236 CTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTM 300

  Fly   266 MELLNQMDGFDSLGQVKMIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARLEILKIHALKIAK 330
            :|||||:|||::...:|:||||||.|.||.|||||||:|||||.|.|||:|||:|||||:.|:..
Human   301 LELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNL 365

  Fly   331 HGEIDYEAIVKLSDNFNGADLRNVCTEAGLFAIRAEREYVIQEDFMKAVRKV--SDNKK 387
            ...|:...|.:|....:||:::.||||||::|:|..|.:|.||||..||.||  .|::|
Human   366 TRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt4NP_572308.3 RPT1 13..395 CDD:224143 182/384 (47%)
AAA 179..311 CDD:278434 83/131 (63%)
PSMC5XP_024306608.1 RPT1 4..431 CDD:224143 182/384 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.