DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt4 and PSMC3

DIOPT Version :9

Sequence 1:NP_572308.3 Gene:Rpt4 / 31567 FlyBaseID:FBgn0028685 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_016873515.1 Gene:PSMC3 / 5702 HGNCID:9549 Length:461 Species:Homo sapiens


Alignment Length:357 Identity:154/357 - (43%)
Similarity:215/357 - (60%) Gaps:26/357 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SEYRKKLLEHKEIEGRLKEKREEIK----------DLTKLYDKSENDLKA------LQSVGQIVG 66
            ||..:...|.:.::.::||..|:||          ::.:|.|...||.:.      |.|..:...
Human    57 SEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKC 121

  Fly    67 EVLKQLTEDKFIVKATNGPRYVVGCRRQLDKAKLKSGTRVALDMTTLTIMRYLPREVDPLVYNMS 131
            .|:|..|...:.:.       |:|.   :|..|||.|..|.::..:..|:..||.|.|..|..|.
Human   122 AVIKTSTRQTYFLP-------VIGL---VDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAME 176

  Fly   132 HEDPGDVTYSAIGGLTDQIRELREVIELPLLNPELFLRVGITPPKGCLLYGPPGTGKTLLARAVA 196
            .::.....||.||||..||:||.|.|.||:.:.|.|..:||.||||.|:||||||||||||||.|
Human   177 VDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACA 241

  Fly   197 SQLDANFLKVVSSAIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREI 261
            :|..|.|||:....:|..:||:.|:|:|:.|..|::..|.|||:||:||||.:||....:.|||:
Human   242 AQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREV 306

  Fly   262 QRTLMELLNQMDGFDSLGQVKMIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARLEILKIHAL 326
            |||::|||||:|||....|||:|.||||.|.|||||||.||||||||.|:|||:||..|::||:.
Human   307 QRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSR 371

  Fly   327 KIAKHGEIDYEAIVKLSDNFNGADLRNVCTEA 358
            |:....:::||.:.:.:|:||||..:.||.||
Human   372 KMNVSPDVNYEELARCTDDFNGAQCKAVCVEA 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt4NP_572308.3 RPT1 13..395 CDD:224143 154/357 (43%)
AAA 179..311 CDD:278434 79/131 (60%)
PSMC3XP_016873515.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.