DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt4 and PSMC2

DIOPT Version :9

Sequence 1:NP_572308.3 Gene:Rpt4 / 31567 FlyBaseID:FBgn0028685 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_002794.1 Gene:PSMC2 / 5701 HGNCID:9548 Length:433 Species:Homo sapiens


Alignment Length:387 Identity:176/387 - (45%)
Similarity:251/387 - (64%) Gaps:19/387 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LRVKALSEYRKKLLEHKEIEGRLKEKREEIKDLTKLYDKSEN-----------DLKALQSVGQI- 64
            |:....|.|.:::   |::|..:::..::|.:||.:.:....           |.:.|||...: 
Human    33 LKTYGQSTYSRQI---KQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQ 94

  Fly    65 VGEVLKQLTED----KFIVKATNGPRYVVGCRRQLDKAKLKSGTRVALDMTTLTIMRYLPREVDP 125
            |....|.:..|    |:|:......::||....|:....::.|.||.:|.....|...||.::||
Human    95 VARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDP 159

  Fly   126 LVYNMSHEDPGDVTYSAIGGLTDQIRELREVIELPLLNPELFLRVGITPPKGCLLYGPPGTGKTL 190
            .|..|..|:..|||||.:||..:||.:||||:|.|||:||.|:.:||.||||.||:|||||||||
Human   160 TVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTL 224

  Fly   191 LARAVASQLDANFLKVVSSAIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGT 255
            .|||||::.||.|::|:.|.:|.||:||.||::||:|..||..:.|:||.||||||||.||.:|.
Human   225 CARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGA 289

  Fly   256 SADREIQRTLMELLNQMDGFDSLGQVKMIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARLEI 320
            ..|.|:|||::||:||:||||..|.:|::|||||||||||||:||||||||||..||:.:.|..|
Human   290 GGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHI 354

  Fly   321 LKIHALKIAKHGEIDYEAIVKLSDNFNGADLRNVCTEAGLFAIRAEREYVIQEDFMKAVRKV 382
            .||||..::...:|.:|.:.:|..|..||::|:||||||:|||||.|:...::||::||.||
Human   355 FKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKV 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt4NP_572308.3 RPT1 13..395 CDD:224143 175/386 (45%)
AAA 179..311 CDD:278434 85/131 (65%)
PSMC2NP_002794.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
RPT1 23..430 CDD:224143 176/387 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.