DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt4 and Rpt2

DIOPT Version :9

Sequence 1:NP_572308.3 Gene:Rpt4 / 31567 FlyBaseID:FBgn0028685 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster


Alignment Length:378 Identity:164/378 - (43%)
Similarity:241/378 - (63%) Gaps:16/378 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RKKLLEHKEIEGRLKEKREEIKDLTKLYDKSE---------NDLKAL-QSVGQIVGEVLKQLTED 75
            |.|||:.:.|:..|..:.|.|::..:|..:.|         :||:.. .|||.     |:::.:|
  Fly    58 RLKLLKLERIKDYLMMEDEFIRNQERLKPQDEKNEEERSKVDDLRGTPMSVGN-----LEEIIDD 117

  Fly    76 KFIVKATN-GPRYVVGCRRQLDKAKLKSGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGDVT 139
            ...:.:|: |..:.|.....:||.:|:.|..|.|:.....::..|..:.||:|..|..|.....|
  Fly   118 NHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQET 182

  Fly   140 YSAIGGLTDQIRELREVIELPLLNPELFLRVGITPPKGCLLYGPPGTGKTLLARAVASQLDANFL 204
            |:.||||..||:|::|.:||||.:||.:..:||.||||.:|||||||||||||:|||:|..|.||
  Fly   183 YADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFL 247

  Fly   205 KVVSSAIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELL 269
            :||.|.::.||:|:..:|:||:|..|.:|.|.|:|:|||||:|.:|:...:..:||||||::|||
  Fly   248 RVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELL 312

  Fly   270 NQMDGFDSLGQVKMIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARLEILKIHALKIAKHGEI 334
            ||:|||||.|.||:||||||.:||||||:||||:|||||.|||:|:.:..|..||..::....::
  Fly   313 NQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDV 377

  Fly   335 DYEAIVKLSDNFNGADLRNVCTEAGLFAIRAEREYVIQEDFMKAVRKVSDNKK 387
            :...::...|:.:|||::.:||||||.|:|..|..|..|||.|:...|...||
  Fly   378 NLSELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKK 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt4NP_572308.3 RPT1 13..395 CDD:224143 164/378 (43%)
AAA 179..311 CDD:278434 82/131 (63%)
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 164/378 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445423
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.