DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt4 and Rpt3R

DIOPT Version :9

Sequence 1:NP_572308.3 Gene:Rpt4 / 31567 FlyBaseID:FBgn0028685 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_649938.2 Gene:Rpt3R / 41190 FlyBaseID:FBgn0037742 Length:405 Species:Drosophila melanogaster


Alignment Length:366 Identity:156/366 - (42%)
Similarity:237/366 - (64%) Gaps:4/366 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YRKKLLEHKEIEGRLKEKREEIKDLTKLYDKSENDLKALQSVGQIVGEVLKQLTEDKFIVKATNG 84
            |:|..:|.:.|:.:....:||.::|.|.:..::.::|.:::|..::|:.|:.:.|:..||.:|.|
  Fly    31 YKKLQMELELIQVQEDYIKEEQRNLKKEFIHAQEEVKRIKAVPLVIGQFLEAVDENNGIVASTTG 95

  Fly    85 PRYVVGCRRQLDKAKLKSGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGDVTYSAIGGLTDQ 149
            ..|.|.....:|:.:||..:.|.|...:..::..:|.|.|..:..:|.::..|::||.||||..|
  Fly    96 SNYYVRVLSTIDREQLKPSSSVGLHKQSNCLVDLVPPEADSTISMLSPDEKPDISYSDIGGLDIQ 160

  Fly   150 IRELREVIELPLLNPELFLRVGITPPKGCLLYGPPGTGKTLLARAVASQLDANFLKVVSSAIVDK 214
            .:|:||.:||||.:.:|:.::||.||:|.||:||||.|||:||:|||....|:|::||.|..|.|
  Fly   161 KQEIREAVELPLTHAQLYKQIGIDPPRGVLLFGPPGCGKTMLAKAVAHHTTASFIRVVGSEFVQK 225

  Fly   215 YIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDSLG 279
            |:||..|::|::|..|:.:.|.|||:||||||..:||...|.||||:||.|:||||||||||...
  Fly   226 YLGEGPRMVRDLFRLAKQNSPSIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDETT 290

  Fly   280 QVKMIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARLEILKIHALKIAKHGEIDYEAIVKLSD 344
            .:|:||||||.||||||||||||||||||:|||:.:.:..:......|:....::|.|.|:...|
  Fly   291 NIKVIMATNRADTLDPALLRPGRLDRKIELPLPDRRQKRLVFTTITSKMNVGEDVDLEDIIARPD 355

  Fly   345 NFNGADLRNVCTEAGLFAIRAEREYVIQEDFMK----AVRK 381
            ..:.||:..:|.|||:.|:|..|..|..:||.|    :|||
  Fly   356 KISNADINAICQEAGMHAVRENRYVVNAKDFEKGYKTSVRK 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt4NP_572308.3 RPT1 13..395 CDD:224143 156/366 (43%)
AAA 179..311 CDD:278434 83/131 (63%)
Rpt3RNP_649938.2 PTZ00454 20..405 CDD:240423 156/366 (43%)
AAA 189..322 CDD:278434 83/132 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445421
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1222
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.