DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt4 and psmc1a

DIOPT Version :9

Sequence 1:NP_572308.3 Gene:Rpt4 / 31567 FlyBaseID:FBgn0028685 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_956327.1 Gene:psmc1a / 336786 ZFINID:ZDB-GENE-030131-8730 Length:440 Species:Danio rerio


Alignment Length:381 Identity:166/381 - (43%)
Similarity:243/381 - (63%) Gaps:16/381 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SEYRKKLLEHKEIEGRLKEKREEIKD---LTKLYDKSE------NDLKAL-QSVGQIVGEVLKQL 72
            ::.|.|||:.:.|:..|..:.|.|:|   :..|.:|.|      :||:.. .|||     .|:::
Zfish    56 TQCRLKLLKQERIKDYLLMEEEFIRDQEQMKPLEEKQEEERSKVDDLRGTPMSVG-----TLEEI 115

  Fly    73 TEDKFIVKATN-GPRYVVGCRRQLDKAKLKSGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPG 136
            .:|...:.:|: |..:.|.....:||..|:.|..|.|:.....::..|..:.||||..|..|...
Zfish   116 IDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAP 180

  Fly   137 DVTYSAIGGLTDQIRELREVIELPLLNPELFLRVGITPPKGCLLYGPPGTGKTLLARAVASQLDA 201
            ..||:.||||..||:|::|.:||||.:||.:..:||.||||.:|||.|||||||||:|||:|..|
Zfish   181 QETYADIGGLDSQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSA 245

  Fly   202 NFLKVVSSAIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLM 266
            .||:||.|.::.||:|:..:|:||:|..|.:|.|.|:|:|||||||.:|:...:..:||||||::
Zfish   246 TFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTML 310

  Fly   267 ELLNQMDGFDSLGQVKMIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARLEILKIHALKIAKH 331
            |||||:|||||.|.||:||||||.:||||||:||||:|||||.|||:|:.:..|.:||..::...
Zfish   311 ELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFQIHTSRMTVA 375

  Fly   332 GEIDYEAIVKLSDNFNGADLRNVCTEAGLFAIRAEREYVIQEDFMKAVRKVSDNKK 387
            .::..:.::...|:.:|||::.:||||||.|:|..|..|..|||.|:...|...|:
Zfish   376 DDVTLDDLILAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQ 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt4NP_572308.3 RPT1 13..395 CDD:224143 166/381 (44%)
AAA 179..311 CDD:278434 82/131 (63%)
psmc1aNP_956327.1 PTZ00361 25..440 CDD:185575 166/381 (44%)
Prot_ATP_ID_OB 108..>176 CDD:293059 20/72 (28%)
AAA 222..355 CDD:278434 82/132 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.