DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt4 and Psmc1

DIOPT Version :9

Sequence 1:NP_572308.3 Gene:Rpt4 / 31567 FlyBaseID:FBgn0028685 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_032973.1 Gene:Psmc1 / 19179 MGIID:106054 Length:440 Species:Mus musculus


Alignment Length:382 Identity:164/382 - (42%)
Similarity:248/382 - (64%) Gaps:19/382 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LRVKALSEY---RKKLLEHKEIEGRLKEKREEIKDLTKLYDKSE-NDLKAL-QSVGQIVGEVLKQ 71
            |:::.:.:|   .::.:.::|....|:||:||        ::|: :||:.. .|||     .|::
Mouse    63 LKLERIKDYLLMEEEFIRNQEQMKPLEEKQEE--------ERSKVDDLRGTPMSVG-----TLEE 114

  Fly    72 LTEDKFIVKATN-GPRYVVGCRRQLDKAKLKSGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDP 135
            :.:|...:.:|: |..:.|.....:||..|:.|..|.|:.....::..|..:.||||..|..|..
Mouse   115 IIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKA 179

  Fly   136 GDVTYSAIGGLTDQIRELREVIELPLLNPELFLRVGITPPKGCLLYGPPGTGKTLLARAVASQLD 200
            ...||:.||||.:||:|::|.:||||.:||.:..:||.||||.:|||||||||||||:|||:|..
Mouse   180 PQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTS 244

  Fly   201 ANFLKVVSSAIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTL 265
            |.||:||.|.::.||:|:..:|:||:|..|.:|.|.|:|:|||||||.:|:...:..:||||||:
Mouse   245 ATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTM 309

  Fly   266 MELLNQMDGFDSLGQVKMIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARLEILKIHALKIAK 330
            :|||||:|||||.|.||:||||||.:||||||:||||:|||||.|||:|:.:..|.:||..::..
Mouse   310 LELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTL 374

  Fly   331 HGEIDYEAIVKLSDNFNGADLRNVCTEAGLFAIRAEREYVIQEDFMKAVRKVSDNKK 387
            ..::..:.::...|:.:|||::.:||||||.|:|..|..|..|||.|:...|...|:
Mouse   375 ADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQ 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt4NP_572308.3 RPT1 13..395 CDD:224143 163/381 (43%)
AAA 179..311 CDD:278434 83/131 (63%)
Psmc1NP_032973.1 PTZ00361 1..440 CDD:185575 164/382 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..104 8/27 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.