DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt4 and Psmc4

DIOPT Version :9

Sequence 1:NP_572308.3 Gene:Rpt4 / 31567 FlyBaseID:FBgn0028685 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_476463.1 Gene:Psmc4 / 117262 RGDID:621102 Length:418 Species:Rattus norvegicus


Alignment Length:389 Identity:166/389 - (42%)
Similarity:245/389 - (62%) Gaps:2/389 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PMPDNLRVKALSEYRKKLLEHKEIEGRLKEKREEIKDLTKLYDKSENDLKALQSVGQIVGEVLKQ 71
            |.|::|. ...|.|:|...|.:.:|.:.:..::|.|:|.|.:..::.::|.:||:..::|:.|:.
  Rat    32 PEPEDLE-DLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEA 95

  Fly    72 LTEDKFIVKATNGPRYVVGCRRQLDKAKLKSGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPG 136
            :.::..||.:|.|..|.|.....:|:..||....|||...:..::..||.|.|..:..::.:...
  Rat    96 VDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKP 160

  Fly   137 DVTYSAIGGLTDQIRELREVIELPLLNPELFLRVGITPPKGCLLYGPPGTGKTLLARAVASQLDA 201
            ||.|:.|||:..|.:|:||.:||||.:.||:.::||.||:|.|:|||||.|||:||:|||....|
  Rat   161 DVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTA 225

  Fly   202 NFLKVVSSAIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLM 266
            .|::||.|..|.||:||..|::|::|..|:::.|.|||:||||||..:||...|.||||:||.|:
  Rat   226 AFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILL 290

  Fly   267 ELLNQMDGFDSLGQVKMIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARLEILKIHALKIAKH 331
            ||||||||||....||:||||||.||||||||||||||||||.|||:.:.:..|......|:...
  Rat   291 ELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLS 355

  Fly   332 GEIDYEAIVKLSDNFNGADLRNVCTEAGLFAIRAEREYVIQEDFMKAVRKVSDNKKLESKLDYK 395
            .|:|.|..|...|..:|||:.::|.|:|:.|:|..|..|:.:||.||.:.|....:.|.:. ||
  Rat   356 EEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEF-YK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt4NP_572308.3 RPT1 13..395 CDD:224143 161/381 (42%)
AAA 179..311 CDD:278434 84/131 (64%)
Psmc4NP_476463.1 PTZ00454 34..418 CDD:240423 163/385 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1222
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.