DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wuho and RACK1B_AT

DIOPT Version :9

Sequence 1:NP_572307.1 Gene:wuho / 31566 FlyBaseID:FBgn0029857 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_175296.1 Gene:RACK1B_AT / 841284 AraportID:AT1G48630 Length:326 Species:Arabidopsis thaliana


Alignment Length:312 Identity:76/312 - (24%)
Similarity:134/312 - (42%) Gaps:53/312 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 GLGCATSTSVQNVAYSPDGQLLAVTTSGKQKALLLYR-SRPENARLLSARPLARASSALR---FC 152
            |..||.:..|..:|...|...:.||:| :.|:::|:: ::.:.:..::.|.:...|..::   ..
plant     9 GTMCAHTDMVTAIATPVDNSDVIVTSS-RDKSIILWKLTKEDKSYGVAQRRMTGHSHFVQDVVLS 72

  Fly   153 SDSSSILVTDKTGDCYQYDCVEVEAPPRLLLGHLSVVYDILWSEDQQHIITCDRDDKIRVTNYPA 217
            ||....|.....|:...:|....|: .|..:||...|..:.:|.|.:.|::..||..|::.|   
plant    73 SDGQFALSGSWDGELRLWDLATGES-TRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKLWN--- 133

  Fly   218 TFDIHSYCL----GHREFVSGLALLTE---QHIASASGDKTLRVWNYIQGKELLQHELPAPAVRL 275
            |.....|.:    ||:|:||.:.....   ..|.|||.|||::|||....|  |::.|...:..|
plant   134 TLGECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCK--LRNTLAGHSGYL 196

  Fly   276 LVRQLEPEKVFQAA------VLFYEHVDALGLYRLERSSDDTWSVTATQLVCAEAGSWSISNFTL 334
            ....:.|:....|:      :|.::..:...||.|                  |||| .|.:...
plant   197 NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL------------------EAGS-IIHSLCF 242

  Fly   335 TSDRIYITGA-ENERLSLRVYDIATGQPASSGVPEGWLKMVLDGLGANEEGA 385
            :.:|.::..| ||   |:|::|:     .|..|.|. ||:.|.......:|:
plant   243 SPNRYWLCAATEN---SIRIWDL-----ESKSVVED-LKVDLKAEAEKTDGS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wuhoNP_572307.1 WD40 repeat 101..142 CDD:293791 9/41 (22%)
WD40 104..361 CDD:295369 65/274 (24%)
WD40 <107..>266 CDD:225201 44/169 (26%)
WD40 repeat 147..184 CDD:293791 7/39 (18%)
WD40 repeat 189..220 CDD:293791 9/30 (30%)
WD40 repeat 233..267 CDD:293791 13/36 (36%)
RACK1B_ATNP_175296.1 WD40 6..321 CDD:238121 76/312 (24%)
WD40 repeat 18..61 CDD:293791 9/43 (21%)
WD40 repeat 67..103 CDD:293791 7/36 (19%)
WD40 repeat 108..144 CDD:293791 10/38 (26%)
WD40 repeat 153..190 CDD:293791 13/38 (34%)
WD40 repeat 196..232 CDD:293791 7/53 (13%)
WD40 repeat 237..279 CDD:293791 14/50 (28%)
WD40 repeat 297..321 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.