DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and Ubqln4

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_277068.1 Gene:Ubqln4 / 94232 MGIID:2150152 Length:596 Species:Mus musculus


Alignment Length:77 Identity:29/77 - (37%)
Similarity:42/77 - (54%) Gaps:5/77 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 RGGMQIFVKTLTGKTITLEVEPSD--SIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212
            |..:::.|||...|.   |:...|  |::..|..|..:.....||..||||||.|:||.|||.:.
Mouse    10 RPQIRVTVKTPKDKE---EIVICDQASVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLSQHG 71

  Fly   213 IQKESTLHLVLR 224
            |:...|:|||::
Mouse    72 IKDGLTVHLVIK 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398 1/1 (100%)
UBQ 77..148 CDD:214563
Ubiquitin 153..228 CDD:176398 28/74 (38%)
UBQ 153..224 CDD:214563 28/72 (39%)
UBQ 229..296 CDD:214563
UBQ 229..296 CDD:294102
Ubqln4NP_277068.1 UBQ 13..83 CDD:214563 28/72 (39%)
hPLIC_N 13..83 CDD:176403 28/72 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..148
STI1 187..224 CDD:128966
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..361
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 482..528
UBA_PLICs 553..592 CDD:270582
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.