DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and ZFAND4

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_016872420.1 Gene:ZFAND4 / 93550 HGNCID:23504 Length:741 Species:Homo sapiens


Alignment Length:277 Identity:56/277 - (20%)
Similarity:94/277 - (33%) Gaps:101/277 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKESTIYLVLRLRGGMQIFVKTLTGKTITL 91
            |.|:.|..:.||                   .:|.......|..|.....|::|::||||....|
Human    53 KVKVMDNRKEPP-------------------FFNDDNMGPFYYRLHFCDTMELFIETLTGTCFEL 98

  Fly    92 EVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKESTIYLVLRLRGGMQIF 156
            .|.|.:|:.:|||||:..|  .|....|....::|::.|                      ::::
Human    99 RVSPFETVISVKAKIRRLE--VPTDDPLRKMAEYLDSSR----------------------VEVW 139

  Fly   157 VKTLTGKTITLEVEP---------------------SDSIENVKARIH--DKEGIPPDQQRLIF- 197
            .||...|.:|..|..                     |||.:.:...:|  .::|    :.|:.: 
Human   140 EKTSCSKQVTFLVYQEGDQLNFFPAVDRGDGTLTPLSDSSKKIDFHLHVLRRKG----EHRMSYC 200

  Fly   198 ---AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT----------GKTITLEVEPSD 249
               :|..:.:..|..|...:..|:         |.||...::|          .|.:.|..:|. 
Human   201 FLCSGGSMYNSDTDEDEETEPSSS---------GQQIIENSITMNKMKLLKAKMKNMNLSKKPK- 255

  Fly   250 TIKHVKARIHDKDGIPP 266
              |.||.:.|     ||
Human   256 --KAVKIKPH-----PP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398 8/48 (17%)
UBQ 1..72 CDD:214563 7/44 (16%)
Ubiquitin 77..152 CDD:176398 20/74 (27%)
UBQ 77..148 CDD:214563 20/70 (29%)
Ubiquitin 153..228 CDD:176398 15/101 (15%)
UBQ 153..224 CDD:214563 15/97 (15%)
UBQ 229..296 CDD:214563 12/48 (25%)
UBQ 229..296 CDD:294102 12/48 (25%)
ZFAND4XP_016872420.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.