DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and OASL

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_003724.1 Gene:OASL / 8638 HGNCID:8090 Length:514 Species:Homo sapiens


Alignment Length:206 Identity:58/206 - (28%)
Similarity:91/206 - (44%) Gaps:36/206 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DKEENPPEHQRLIFGGKHLENGRTLSDYNIQKESTIYLVLRLRGGMQIFVKTLTGKTITLEVEPS 96
            |..|||                  :|.:|:::...|:|.:..||          .....|.|.|.
Human   337 DNRENP------------------ISSWNVKRA
RDIHLTVEQRG----------YPDFNLIVNPY 373

  Fly    97 DTIENVKAKIQDKEENPPEHQRLIF---GGKH--LENGRTLSDYNIQKESTIYLVLRLRGGMQIF 156
            :.|..||.||: :.......|||.|   |.:.  |.:..:|:.|.|...:.|||:..:...:|:|
Human   374 EPIRKVKEKIR-RTRGYSGLQRLSFQVPGSERQLLSSRCSLAKYGIFSHTHIYLLETIPSE
IQVF 437

  Fly   157 VKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 221
            ||...|.:....:.|:..|..:|.:|.|::|:|..||:|.|.|:.|:|...|..|.||...|  |
Human   438 VKNPDGGSYAYAINPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDWLGLGIYGIQDSDT--L 500

  Fly   222 VLRLRGGMQIF 232
            :|..:.|..:|
Human   501 ILSKKK
GEALF 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398 9/43 (21%)
UBQ 1..72 CDD:214563 8/39 (21%)
Ubiquitin 77..152 CDD:176398 20/79 (25%)
UBQ 77..148 CDD:214563 20/75 (27%)
Ubiquitin 153..228 CDD:176398 26/74 (35%)
UBQ 153..224 CDD:214563 25/70 (36%)
UBQ 229..296 CDD:214563 1/4 (25%)
UBQ 229..296 CDD:294102 1/4 (25%)
OASLNP_003724.1 NT_2-5OAS_ClassI-CCAase 29..212 CDD:143390
OAS1_C 168..351 CDD:313619 6/31 (19%)
OASL_repeat1 354..433 CDD:176406 24/89 (27%)
ubiquitin 436..506 CDD:306702 25/71 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.