Sequence 1: | NP_572306.1 | Gene: | CG11700 / 31564 | FlyBaseID: | FBgn0029856 | Length: | 301 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_003724.1 | Gene: | OASL / 8638 | HGNCID: | 8090 | Length: | 514 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 58/206 - (28%) |
---|---|---|---|
Similarity: | 91/206 - (44%) | Gaps: | 36/206 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 DKEENPPEHQRLIFGGKHLENGRTLSDYNIQKESTIYLVLRLRGGMQIFVKTLTGKTITLEVEPS 96
Fly 97 DTIENVKAKIQDKEENPPEHQRLIF---GGKH--LENGRTLSDYNIQKESTIYLVLRLRGGMQIF 156
Fly 157 VKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 221
Fly 222 VLRLRGGMQIF 232 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11700 | NP_572306.1 | Ubiquitin | 1..76 | CDD:176398 | 9/43 (21%) |
UBQ | 1..72 | CDD:214563 | 8/39 (21%) | ||
Ubiquitin | 77..152 | CDD:176398 | 20/79 (25%) | ||
UBQ | 77..148 | CDD:214563 | 20/75 (27%) | ||
Ubiquitin | 153..228 | CDD:176398 | 26/74 (35%) | ||
UBQ | 153..224 | CDD:214563 | 25/70 (36%) | ||
UBQ | 229..296 | CDD:214563 | 1/4 (25%) | ||
UBQ | 229..296 | CDD:294102 | 1/4 (25%) | ||
OASL | NP_003724.1 | NT_2-5OAS_ClassI-CCAase | 29..212 | CDD:143390 | |
OAS1_C | 168..351 | CDD:313619 | 6/31 (19%) | ||
OASL_repeat1 | 354..433 | CDD:176406 | 24/89 (27%) | ||
ubiquitin | 436..506 | CDD:306702 | 25/71 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5272 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |