DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and RAD23

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_010877.3 Gene:RAD23 / 856674 SGDID:S000000763 Length:398 Species:Saccharomyces cerevisiae


Alignment Length:227 Identity:41/227 - (18%)
Similarity:78/227 - (34%) Gaps:40/227 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKESTIYLV 70
            |....:.:.|::|||:||...|.|:...........:||:.||.|::.:|:|:..::....:..:
Yeast     7 KNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFM 71

  Fly    71 LRLRGGMQIFV---------KTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQR-------- 118
            :..:...:..|         .|..|:..:.|..||.......|....:...|.|.|.        
Yeast    72 VSQKKSTKTKVTEPPIAPESATTPGRENSTEASPSTDASAAPAATAPEGSQPQEEQTATTERTES 136

  Fly   119 -----LIFGGKHLENGRTLSDYNIQKESTIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDSIENV 178
                 .:.|.:..|....:.:...|:|.   :...||....               .|..::|.:
Yeast   137 ASTPGFVVGTERNETIERIMEMGYQREE---VERALRAAFN---------------NPDRAVEYL 183

  Fly   179 KARIHDKEGIPPDQQRLIFAGKQLEDGRTLSD 210
            ...|.:....|..||:...|.:|.....|.::
Yeast   184 LMGIPENLRQPEPQQQTAAAAEQPSTAATTAE 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398 16/69 (23%)
UBQ 1..72 CDD:214563 16/65 (25%)
Ubiquitin 77..152 CDD:176398 16/96 (17%)
UBQ 77..148 CDD:214563 14/92 (15%)
Ubiquitin 153..228 CDD:176398 9/58 (16%)
UBQ 153..224 CDD:214563 9/58 (16%)
UBQ 229..296 CDD:214563
UBQ 229..296 CDD:294102
RAD23NP_010877.3 rad23 2..398 CDD:273167 41/227 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.