DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and DSK2

DIOPT Version :10

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_014003.1 Gene:DSK2 / 855319 SGDID:S000004889 Length:373 Species:Saccharomyces cerevisiae


Alignment Length:56 Identity:22/56 - (39%)
Similarity:34/56 - (60%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 LEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222
            :.|.|..::...|..|:...|||...||||::||.|:|.:|:..|:||...::|||
Yeast    16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubl1_cv_Nsp3_N-like 1..76 CDD:475130
Ubl1_cv_Nsp3_N-like 77..152 CDD:475130
Ubl_ubiquitin 153..228 CDD:340501 22/56 (39%)
Ubl1_cv_Nsp3_N-like 229..296 CDD:475130
DSK2NP_014003.1 Ubl_Dsk2p_like 3..74 CDD:340523 22/56 (39%)
STI1 149..185 CDD:128966
UBA_Dsk2p_like 328..369 CDD:270509
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.