DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and MDY2

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_014530.1 Gene:MDY2 / 854038 SGDID:S000005471 Length:212 Species:Saccharomyces cerevisiae


Alignment Length:245 Identity:54/245 - (22%)
Similarity:86/245 - (35%) Gaps:72/245 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PEHQRLIFGGKHLENGRTLSDYNIQKESTIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENV 102
            |||:   |..|.|... ||::..:.|.               :.|.|  |.:|....|..|:: .
Yeast     8 PEHE---FVSKFLTLA-TLTEPKLPKS---------------YTKPL--KDVTNLGVPLPTLK-Y 50

  Fly   103 KAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKESTIYLVLRLRGGMQIFVKTLTGK-TIT 166
            |.| |::.:....||                |...|..:.::|.|:         |....| :|.
Yeast    51 KYK-QNRAKKLKLHQ----------------DQQGQDNAAVHLTLK---------KIQAPKFSIE 89

  Fly   167 LEVEPSDSIENVKAR-IHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQ 230
            .:..|||:|..:|.. |.:::.....:.:|:..||.|.|...|||..:                 
Yeast    90 HDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKV----------------- 137

  Fly   231 IFVKTLTGKTITLEVEPSDTI-KHVKARIHDKDGIPPDHQRLIFAGKQLE 279
                |....|||:.::|:.|| |..:|........|...|.|......:|
Yeast   138 ----TPANSTITVMIKPNPTISKEPEAEKSTNSPAPAPPQELTVPWDDIE 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398 9/37 (24%)
UBQ 1..72 CDD:214563 9/33 (27%)
Ubiquitin 77..152 CDD:176398 15/74 (20%)
UBQ 77..148 CDD:214563 14/70 (20%)
Ubiquitin 153..228 CDD:176398 17/76 (22%)
UBQ 153..224 CDD:214563 17/72 (24%)
UBQ 229..296 CDD:214563 13/52 (25%)
UBQ 229..296 CDD:294102 13/52 (25%)
MDY2NP_014530.1 Get5_bdg 8..59 CDD:407090 18/73 (25%)
Ubl_Rad23 74..148 CDD:340503 23/103 (22%)
Get5_C 174..212 CDD:408303 2/10 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.