DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and RUB1

DIOPT Version :10

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_010423.4 Gene:RUB1 / 851717 SGDID:S000002546 Length:77 Species:Saccharomyces cerevisiae


Alignment Length:76 Identity:40/76 - (52%)
Similarity:57/76 - (75%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 MQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES 217
            |.:.|||||||.|::|::.||.:.::|..:.:||||||.||||||.|||::|..|::|.::.:..
Yeast     1 MIVKVKTLTGKEISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAHLVEGM 65

  Fly   218 TLHLVLRLRGG 228
            .|||||.||||
Yeast    66 QLHLVLTLRGG 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubl1_cv_Nsp3_N-like 1..76 CDD:475130
Ubl1_cv_Nsp3_N-like 77..152 CDD:475130
Ubl_ubiquitin 153..228 CDD:340501 38/74 (51%)
Ubl1_cv_Nsp3_N-like 229..296 CDD:475130 40/76 (53%)
RUB1NP_010423.4 Ubl_NEDD8 3..76 CDD:340504 37/72 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.