DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and RAD23B

DIOPT Version :10

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001185439.1 Gene:RAD23B / 844304 AraportID:AT1G79650 Length:395 Species:Arabidopsis thaliana


Alignment Length:70 Identity:29/70 - (41%)
Similarity:37/70 - (52%) Gaps:3/70 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 MQIFVKTLTGKTITLEVEPSDTIKHVKARIHD---KDGIPPDHQRLIFAGKQLEDGRTLSDYNIQ 290
            |::.||||.|....:.|.|||||..||..|.|   ||..|...|.||..||.|:|..:|.:..:.
plant     1 MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLVENKVT 65

  Fly   291 KESTL 295
            :|..|
plant    66 EEGFL 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubl1_cv_Nsp3_N-like 1..76 CDD:475130
Ubl1_cv_Nsp3_N-like 77..152 CDD:475130
Ubl_ubiquitin 153..228 CDD:340501
Ubl1_cv_Nsp3_N-like 229..296 CDD:475130 29/70 (41%)
RAD23BNP_001185439.1 rad23 1..392 CDD:273167 29/70 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.