DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and UBQ13

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_176714.4 Gene:UBQ13 / 842845 AraportID:AT1G65350 Length:319 Species:Arabidopsis thaliana


Alignment Length:310 Identity:252/310 - (81%)
Similarity:272/310 - (87%) Gaps:15/310 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKES 65
            ||||||||||||||||||.||||:||||||||||..||:.|||||.||.||:||||:||||||||
plant     1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES 65

  Fly    66 TIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGR 130
            |::||||||||||||||||||||||||||.||||:||||||||||..||:.|||||.||.||:||
plant    66 TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR 130

  Fly   131 TLSDYNIQKESTIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRL 195
            ||:| |||||||::||||||||||||||||||||||||||.||:|:||||:|.|||.||||||||
plant   131 TLAD-NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRL 194

  Fly   196 IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIKHVKARIHD 260
            |||||||||||||:|||||||||||||||||||||||||||||||||||||.|.||.:|||:|.|
plant   195 IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSGTIDNVKAKIQD 259

  Fly   261 KDGIPPDHQRLIFAGKQLEDG--------------RTLSDYNIQKESTLH 296
            |:|||||.|||||||||||.|              ..|:|||||||||||
plant   260 KEGIPPDQQRLIFAGKQLEGGPGGGGGHFQKAEALAFLADYNIQKESTLH 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398 62/74 (84%)
UBQ 1..72 CDD:214563 58/70 (83%)
Ubiquitin 77..152 CDD:176398 61/74 (82%)
UBQ 77..148 CDD:214563 57/70 (81%)
Ubiquitin 153..228 CDD:176398 67/74 (91%)
UBQ 153..224 CDD:214563 63/70 (90%)
UBQ 229..296 CDD:214563 54/80 (68%)
UBQ 229..296 CDD:294102 54/80 (68%)
UBQ13NP_176714.4 Ubiquitin 1..76 CDD:176398 62/74 (84%)
UBQ 1..72 CDD:214563 58/70 (83%)
Ubiquitin 77..151 CDD:176398 61/74 (82%)
UBQ 77..147 CDD:214563 57/70 (81%)
Ubiquitin 152..227 CDD:176398 67/74 (91%)
UBQ 152..223 CDD:214563 63/70 (90%)
UBQ 228..317 CDD:294102 56/82 (68%)
UBQ 228..313 CDD:214563 56/82 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54325
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000540
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.