DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and UBQ12

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_564675.1 Gene:UBQ12 / 841949 AraportID:AT1G55060 Length:230 Species:Arabidopsis thaliana


Alignment Length:228 Identity:185/228 - (81%)
Similarity:207/228 - (90%) Gaps:0/228 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKES 65
            ||||:|||||||..||||.||||:||||||||.|..||:..||||.||.||:||||:|||:|::|
plant     1 MQIFLKTLTGKTKVLEVESSDTIDNVKAKIQDIEGIPPDQHRLIFAGKQLEDGRTLADYNVQEDS 65

  Fly    66 TIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGR 130
            |::|:||.|||||||||||||||||||||.||||:|:||||||||..||:.|||||.||.||:||
plant    66 TLHLLLRFRGGMQIFVKTLTGKTITLEVESSDTIDNLKAKIQDKEGIPPDQQRLIFAGKQLEDGR 130

  Fly   131 TLSDYNIQKESTIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRL 195
            ||:|||||||||::||||||||||||||||||||||||||.||:|:||||:|.|||||.||||||
plant   131 TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGISPDQQRL 195

  Fly   196 IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG 228
            ||||||.||||||:|||||||||||||||||||
plant   196 IFAGKQHEDGRTLADYNIQKESTLHLVLRLRGG 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398 52/74 (70%)
UBQ 1..72 CDD:214563 49/70 (70%)
Ubiquitin 77..152 CDD:176398 61/74 (82%)
UBQ 77..148 CDD:214563 57/70 (81%)
Ubiquitin 153..228 CDD:176398 66/74 (89%)
UBQ 153..224 CDD:214563 62/70 (89%)
UBQ 229..296 CDD:214563 185/228 (81%)
UBQ 229..296 CDD:294102 185/228 (81%)
UBQ12NP_564675.1 UBQ 1..76 CDD:294102 52/74 (70%)
UBQ 1..72 CDD:214563 49/70 (70%)
Ubiquitin 77..152 CDD:176398 61/74 (82%)
UBQ 77..148 CDD:214563 57/70 (81%)
Ubiquitin 153..228 CDD:176398 66/74 (89%)
UBQ 153..224 CDD:214563 62/70 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54325
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000540
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.