DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and AT1G23410

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_173755.1 Gene:AT1G23410 / 838949 AraportID:AT1G23410 Length:156 Species:Arabidopsis thaliana


Alignment Length:106 Identity:78/106 - (73%)
Similarity:84/106 - (79%) Gaps:4/106 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 MQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES 217
            ||||||||||||||||||.||:|:||||:|.|||||||||||||||||||||||||:||||||||
plant     1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES 65

  Fly   218 TLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIKHVKARI 258
            |||||||||||    .|....||.|...:...|.|.||..:
plant    66 TLHLVLRLRGG----AKKRKKKTYTKPKKIKHTHKKVKLAV 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398
UBQ 77..148 CDD:214563
Ubiquitin 153..228 CDD:176398 68/74 (92%)
UBQ 153..224 CDD:214563 64/70 (91%)
UBQ 229..296 CDD:214563 8/30 (27%)
UBQ 229..296 CDD:294102 8/30 (27%)
AT1G23410NP_173755.1 Ubl_ubiquitin 1..76 CDD:340501 68/74 (92%)
Ribosomal_S27 103..147 CDD:396259 78/106 (74%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.