DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and AT5G24240

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001318634.1 Gene:AT5G24240 / 832491 AraportID:AT5G24240 Length:574 Species:Arabidopsis thaliana


Alignment Length:142 Identity:49/142 - (34%)
Similarity:78/142 - (54%) Gaps:5/142 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 TLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQL-EDGRTLSDYNIQKESTLHLV 222
            |:.|..|...|..||||.:||.||...:|....:|:|::.|::: .:...:.||.:.....||||
plant    38 TIAGSVIPKRVMESDSIASVKLRIQSIKGFFVKKQKLLYDGREVSRNDSQIRDYGLADGKLLHLV 102

  Fly   223 LRLRGGMQIFVKTLTGKTITLEVEPSDTIKHVKARIHDKD---GIPPDHQRLIFAGKQLEDGRTL 284
            :||.....|.|:|:.||...|.||.|..:.:||.:|..|:   |||.||: |...|::|:|.|.:
plant   103 IRL
SDLQAISVRTVDGKEFELVVERSRNVGYVKQQIASKEKELGIPRDHE-LTLDGEELDDQRLI 166

  Fly   285 SDYNIQKESTLH 296
            :|.....::.:|
plant   167 TDLCQNGDNVIH 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398
UBQ 77..148 CDD:214563
Ubiquitin 153..228 CDD:176398 24/69 (35%)
UBQ 153..224 CDD:214563 22/65 (34%)
UBQ 229..296 CDD:214563 24/69 (35%)
UBQ 229..296 CDD:294102 24/69 (35%)
AT5G24240NP_001318634.1 Ubiquitin_like_fold 34..105 CDD:421700 22/66 (33%)
Ubl_ubiquitin_like 111..180 CDD:340559 25/69 (36%)
PI3_PI4_kinase 266..521 CDD:395364
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.