DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and AT5G11080

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001190287.1 Gene:AT5G11080 / 830975 AraportID:AT5G11080 Length:373 Species:Arabidopsis thaliana


Alignment Length:296 Identity:65/296 - (21%)
Similarity:109/296 - (36%) Gaps:88/296 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 MQIFVKTLTGKTITLEVE--------------PSDTIENVKAKIQDKEEN-------PPEHQ-RL 119
            ::|.:|.|...|.||.||              |...:.::...::|.:::       .||.| ||
plant    11 IRIKIKILHSTTHTLSVERTVRLFFMVKNCVFPCVLLYSIMIPVRDLKQDICYYCGVSPERQPRL 75

  Fly   120 IFGGKHLENGRTLSDYNIQKESTIYLVLRLRGG--MQIFVK-----------TLTGKTITLEVE- 170
            :|.|:.|:|.:.||||::::..|:|||   :|.  :.:|..           |||..:..|... 
plant    76 LFRGRVLKNDQRLSDYHVEEGHTLYLV---KGSPPIPLFSSNAAANSNLGRGTLTDHSYQLTARG 137

  Fly   171 ---PS----DSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTL--------- 219
               ||    |||..:...:        |:.|.:||.....|.......|..:|..:         
plant   138 YDTPSVVIPDSITTLSRHL--------DRIRQVFATYGNNDDNNWQAPNRSREDLIARECHWGEL 194

  Fly   220 -HLVLRLRGGM--------------QIFVKTLTGKTITLE--VEPSDTIKHVKARIHDKDGIPPD 267
             |...||..|.              |:.|...:.:.:..|  ||....:.|:.:.|     :...
plant   195 AHTTRRLLIGEVAECLSNISMLLVDQVNVTDPSARRLRQERVVESGSLLCHLGSSI-----LALG 254

  Fly   268 H--QRLIFAGKQLEDGRTLSDYNIQKESTLHSHFKW 301
            |  .|:.....|.:.||.:. .:...::.|.||..|
plant   255 HGTSRISMGETQDDVGRAVF-ISPTGQNRLQSHHSW 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398 27/96 (28%)
UBQ 77..148 CDD:214563 27/92 (29%)
Ubiquitin 153..228 CDD:176398 20/103 (19%)
UBQ 153..224 CDD:214563 18/99 (18%)
UBQ 229..296 CDD:214563 12/84 (14%)
UBQ 229..296 CDD:294102 12/84 (14%)
AT5G11080NP_001190287.1 UBQ 11..104 CDD:294102 27/95 (28%)
UBQ 11..102 CDD:214563 25/90 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D286959at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.