DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and AT4G03360

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_192245.2 Gene:AT4G03360 / 827958 AraportID:AT4G03360 Length:322 Species:Arabidopsis thaliana


Alignment Length:302 Identity:63/302 - (20%)
Similarity:113/302 - (37%) Gaps:88/302 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKES 65
            :::.::..:|.:.|::|...||:..:|.||:..:..|...|.|||..|.|::...:....|:..|
plant    40 IKVIIENQSGSSFTIDVSFWDTVLMIKRKIEMTQGTPVSKQILIFKRKVLQDHLNMFGCQIRHNS 104

  Fly    66 TIYLVL-------------------RLRGGMQIFVKT----LTGKTITLEVEPSDTIENVKAKIQ 107
            .|.|.:                   .....:..||..    |:.|:..|.:|          |..
plant   105 RILLSISPDDNPTQNQVPQTNQSPSTPSNPIHEFVNNQDSPLSPKSSALTME----------KFS 159

  Fly   108 DKEENPPEHQRLIFGGKHLENGRTLSDYNIQKESTIYLVLRLRGGMQIFVKTLTGKTITLEVE-- 170
            ..:::.|...|::  .|.::||.:...|::.:      :|..|....:.|.::..:  ..||:  
plant   160 KNQQDRPPLMRVV--AKRIDNGSSRPSYSLDE------LLAPRDSSTVAVGSIRNR--DQEVKNR 214

  Fly   171 ---PSDSIENVKARIHDKEGI-------PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV--- 222
               ||||:|.| ..|.|...:       |....|:|    |:|   ..:|.|:: |....||   
plant   215 VSSPSDSVEEV-INITDSLAMKMIVMVQPYGYTRMI----QVE---VTADDNVE-ELRKELVKMQ 270

  Fly   223 ----LRLRGGMQIFVKTLTGKTITLEVEPSDTIKHVKARIHD 260
                |.|..||...:.                 ||.:|.:|:
plant   271 ERGELNLPQGMYYLIH-----------------KHKQAVLHE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398 19/93 (20%)
UBQ 1..72 CDD:214563 19/89 (21%)
Ubiquitin 77..152 CDD:176398 15/78 (19%)
UBQ 77..148 CDD:214563 13/74 (18%)
Ubiquitin 153..228 CDD:176398 23/93 (25%)
UBQ 153..224 CDD:214563 21/89 (24%)
UBQ 229..296 CDD:214563 5/32 (16%)
UBQ 229..296 CDD:294102 5/32 (16%)
AT4G03360NP_192245.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.