DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and UBQ10

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_849299.4 Gene:UBQ10 / 825880 AraportID:AT4G05320 Length:457 Species:Arabidopsis thaliana


Alignment Length:296 Identity:258/296 - (87%)
Similarity:278/296 - (93%) Gaps:0/296 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKES 65
            ||||||||||||||||||.||||:||||||||||..||:.|||||.||.||:||||:||||||||
plant     1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES 65

  Fly    66 TIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGR 130
            |::||||||||||||||||||||||||||.||||:||||||||||..||:.|||||.||.||:||
plant    66 TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR 130

  Fly   131 TLSDYNIQKESTIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRL 195
            ||:|||||||||::||||||||||||||||||||||||||.||:|:||||:|.||||||||||||
plant   131 TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL 195

  Fly   196 IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIKHVKARIHD 260
            |||||||||||||:|||||||||||||||||||||||||||||||||||||.||||.:|||:|.|
plant   196 IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD 260

  Fly   261 KDGIPPDHQRLIFAGKQLEDGRTLSDYNIQKESTLH 296
            |:|||||.||||||||||||||||:|||||||||||
plant   261 KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398 62/74 (84%)
UBQ 1..72 CDD:214563 58/70 (83%)
Ubiquitin 77..152 CDD:176398 62/74 (84%)
UBQ 77..148 CDD:214563 58/70 (83%)
Ubiquitin 153..228 CDD:176398 68/74 (92%)
UBQ 153..224 CDD:214563 64/70 (91%)
UBQ 229..296 CDD:214563 58/66 (88%)
UBQ 229..296 CDD:294102 58/66 (88%)
UBQ10NP_849299.4 Ubl_ubiquitin 1..76 CDD:340501 62/74 (84%)
Ubl_ubiquitin 77..152 CDD:340501 62/74 (84%)
Ubl_ubiquitin 153..228 CDD:340501 68/74 (92%)
Ubl_ubiquitin 229..304 CDD:340501 60/68 (88%)
Ubl_ubiquitin 305..380 CDD:340501
Ubl_ubiquitin 381..456 CDD:340501
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54325
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000540
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.