DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and AT4G05260

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_192435.1 Gene:AT4G05260 / 825874 AraportID:AT4G05260 Length:259 Species:Arabidopsis thaliana


Alignment Length:323 Identity:66/323 - (20%)
Similarity:106/323 - (32%) Gaps:102/323 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGG---KHLENGRTLSDYNIQ 62
            |.::.:|..|:...:|:...||:..:|.||:..:..|..:|.|.||.   .||:.|:        
plant     1 MDVYFETQNGRKFCIELGYWDTVLEIKKKIEKYQRIPVPNQTLFFGNALEDHLDIGQ-------- 57

  Fly    63 KESTIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLE 127
                              .|.|....:.|.|.|.....|  .::...||.||....||:|     
plant    58 ------------------CKILQNSHVVLFVLPDPNDNN--DQVLQTEEQPPIIGDLIYG----- 97

  Fly   128 NGRTLSDYNIQKESTIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQ 192
                 .|..:..|                        :.|.:.|...:::...|.:| :..|.|.
plant    98 -----EDLPLTTE------------------------VVLNIRPFCPVQDSPVRNND-QSPPSDA 132

  Fly   193 QRLIFAGKQLEDGR----------TLSDYNIQKESTLHLVLRLR-----GGMQ-------IFVKT 235
            .:.|..|.|....|          ...:.|||......::|.||     |.::       |..||
plant   133 AKDIIKGHQDSPVRNNEQTPPSDSVKENTNIQDSPVGKIILTLRVMPYSGKIKAAKNLHFITYKT 197

  Fly   236 LTGKTITLEVEPSDTIKHVKARIHDKDGIPPDHQRLIFAGKQLEDGRTLS-DYNIQKESTLHS 297
            ...|.:..|:..::...|:. |..|.|        ..|..|    ||.|: |.:.:..|..|:
plant   198 YRVKMLRQELVQNELRDHLD-RPQDGD--------YFFVHK----GRVLNEDQSFEWNSVAHT 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398 17/77 (22%)
UBQ 1..72 CDD:214563 17/73 (23%)
Ubiquitin 77..152 CDD:176398 15/74 (20%)
UBQ 77..148 CDD:214563 15/70 (21%)
Ubiquitin 153..228 CDD:176398 16/89 (18%)
UBQ 153..224 CDD:214563 13/80 (16%)
UBQ 229..296 CDD:214563 16/74 (22%)
UBQ 229..296 CDD:294102 16/74 (22%)
AT4G05260NP_192435.1 ubiquitin 3..70 CDD:395184 19/92 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.