DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and RAD23C

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_186903.1 Gene:RAD23C / 821195 AraportID:AT3G02540 Length:419 Species:Arabidopsis thaliana


Alignment Length:250 Identity:55/250 - (22%)
Similarity:92/250 - (36%) Gaps:73/250 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKI---QDKEENPPEHQRLIFGGKHLENGRTLSDYNIQ 62
            |:||||||.|....:||:|.|::.:||..|   |..:..|...|.||..||.|::..|:.:..:.
plant     1 MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIEENKVA 65

  Fly    63 KESTIYLVLRLR----------------------GGMQIFVKTLTGKTITLEVEPSDT------- 98
            :.|.|.:::...                      ...|..:...|..:::..|.|:.|       
plant    66 ENSFIVIMMNKSKPASAAASSASAGTSQAKSIPPSTSQPSISPQTPASVSAPVAPAPTRPPPPAP 130

  Fly    99 ---------IENVKAKIQD------------KEENPPEHQRLIFG--GKHLENGRTLSDYNIQKE 140
                     .|.|...|.:            .:..|...|..::|  ..:|..|..|       |
plant   131 TPTPAPVAATETVTTPIPEPVPATISSSTPAPDSAPVGSQGDVYGQAASNLAAGSNL-------E 188

  Fly   141 STIYLVLRLRGGMQIFVKTLTGKTITLEV-----EPSDSIENVKARIHDKEGIPP 190
            |||..:|.:.||      |...:|:.|.:     .|..::|.:...|.::..:||
plant   189 STIQQILDMGGG------TWDRETVVLALRAAFNNPERAVEYLYTGIPEQAEVPP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398 26/99 (26%)
UBQ 1..72 CDD:214563 26/73 (36%)
Ubiquitin 77..152 CDD:176398 19/104 (18%)
UBQ 77..148 CDD:214563 18/100 (18%)
Ubiquitin 153..228 CDD:176398 7/42 (17%)
UBQ 153..224 CDD:214563 7/42 (17%)
UBQ 229..296 CDD:214563
UBQ 229..296 CDD:294102
RAD23CNP_186903.1 rad23 1..416 CDD:273167 54/249 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.