Sequence 1: | NP_572306.1 | Gene: | CG11700 / 31564 | FlyBaseID: | FBgn0029856 | Length: | 301 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_186903.1 | Gene: | RAD23C / 821195 | AraportID: | AT3G02540 | Length: | 419 | Species: | Arabidopsis thaliana |
Alignment Length: | 250 | Identity: | 55/250 - (22%) |
---|---|---|---|
Similarity: | 92/250 - (36%) | Gaps: | 73/250 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MQIFVKTLTGKTITLEVEPSDTIENVKAKI---QDKEENPPEHQRLIFGGKHLENGRTLSDYNIQ 62
Fly 63 KESTIYLVLRLR----------------------GGMQIFVKTLTGKTITLEVEPSDT------- 98
Fly 99 ---------IENVKAKIQD------------KEENPPEHQRLIFG--GKHLENGRTLSDYNIQKE 140
Fly 141 STIYLVLRLRGGMQIFVKTLTGKTITLEV-----EPSDSIENVKARIHDKEGIPP 190 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11700 | NP_572306.1 | Ubiquitin | 1..76 | CDD:176398 | 26/99 (26%) |
UBQ | 1..72 | CDD:214563 | 26/73 (36%) | ||
Ubiquitin | 77..152 | CDD:176398 | 19/104 (18%) | ||
UBQ | 77..148 | CDD:214563 | 18/100 (18%) | ||
Ubiquitin | 153..228 | CDD:176398 | 7/42 (17%) | ||
UBQ | 153..224 | CDD:214563 | 7/42 (17%) | ||
UBQ | 229..296 | CDD:214563 | |||
UBQ | 229..296 | CDD:294102 | |||
RAD23C | NP_186903.1 | rad23 | 1..416 | CDD:273167 | 54/249 (22%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5272 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |