DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and UBQ6

DIOPT Version :10

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_566095.1 Gene:UBQ6 / 819323 AraportID:AT2G47110 Length:157 Species:Arabidopsis thaliana


Alignment Length:106 Identity:78/106 - (73%)
Similarity:85/106 - (80%) Gaps:8/106 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 MQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES 217
            ||||||||||||||||||.||:|:||||:|.|||||||||||||||||||||||||:||||||||
plant     1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES 65

  Fly   218 TLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIKHVKARI 258
            |||||||||||    .|....||.|   :|. .|||...::
plant    66 TLHLVLRLRGG----AKKRKKKTYT---KPK-KIKHKHKKV 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubl1_cv_Nsp3_N-like 1..76 CDD:475130
Ubl1_cv_Nsp3_N-like 77..152 CDD:475130
Ubl_ubiquitin 153..228 CDD:340501 68/74 (92%)
Ubl1_cv_Nsp3_N-like 229..296 CDD:475130 8/30 (27%)
UBQ6NP_566095.1 Ubl_ubiquitin 1..76 CDD:340501 68/74 (92%)
Ribosomal_S27 103..147 CDD:460261
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.