DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and PI4K GAMMA 4

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_566076.1 Gene:PI4K GAMMA 4 / 819260 AraportID:AT2G46500 Length:566 Species:Arabidopsis thaliana


Alignment Length:193 Identity:60/193 - (31%)
Similarity:96/193 - (49%) Gaps:20/193 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 TLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHL-ENGRTLSDYNIQKESTIYLV 146
            ||.|..|.:.|..||:||:||.:||........:|:|:|||:.| .:...:.||.:.:.:.::||
plant    40 TLPGSVIPMRVLESDSIESVKLRIQSYRGFVVRNQKLVFGGRELARSNSNMRDYGVSEGNILHLV 104

  Fly   147 LRLRGGMQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEG--IPPDQQRLIFAGKQLEDGRTLS 209
            |:|.....:.|||..||.....||...:|..||.:|..|.|  :.||:|.:::.|::|||...::
plant   105 LKL
SDLQVLDVKTTCGKHCRFHVERGRNIGYVKKQISKKRGDFVDPDEQEILYEGEKLEDQSLIN 169

  Fly   210 DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIKHVKARIHDKDG------IPP 266
            |.....:|.|||::|           .:.|.....||.:..:..|..:..||.|      :||
plant   170 DICRNDDSVLHLL
VR-----------RSAKVRVKPVEKNFELSIVAPQAKDKKGREAKSIVPP 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398 25/69 (36%)
UBQ 77..148 CDD:214563 23/65 (35%)
Ubiquitin 153..228 CDD:176398 26/76 (34%)
UBQ 153..224 CDD:214563 25/72 (35%)
UBQ 229..296 CDD:214563 9/44 (20%)
UBQ 229..296 CDD:294102 9/44 (20%)
PI4K GAMMA 4NP_566076.1 Ubiquitin_like_fold 39..107 CDD:421700 24/66 (36%)
Ubl_ubiquitin_like 115..182 CDD:340559 24/66 (36%)
PI3_PI4_kinase 264..513 CDD:395364
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.