DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and AT2G32350

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_180794.2 Gene:AT2G32350 / 817796 AraportID:AT2G32350 Length:242 Species:Arabidopsis thaliana


Alignment Length:236 Identity:50/236 - (21%)
Similarity:100/236 - (42%) Gaps:37/236 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKEST------------- 142
            :|:...:::..||.::....:.|.....|......|.:|..:.||.|....|             
plant     1 MEISEQESVLEVKKRLGQFLQIPTSSITLFVSCWELIDGLDIEDYPIISHGTRIDLTVTPLFTAP 65

  Fly   143 --IYLVLRLRGGMQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQL-ED 204
              |:..:|   .:.:.|| ...|..|:||:.::::.::|.:||..|..|..:.:|.::|.:| :|
plant    66 SFIHAAVR---KIHVTVK-FPSKQFTVEVDRTETVSSLKDKIHIVENTPIKRMQLYYSGIELADD 126

  Fly   205 GRTLSDYNIQKESTLHLVL-------------RLRGGMQIFVKTLTGKTITLEVEPSDTIKHVKA 256
            .|.|::|.|.:.|.:.:.|             :|...:|.......|..|.:|::.:.||..::.
plant   127 YRNLNEYGITEFSEIVVFLKSINRAKDVAPVRKLCFLVQTSSSLFNGARIPVEIKDTCTISEMRE 191

  Fly   257 RIHDKDGIPPDHQRLIFAGKQ--LEDGRTLSDYNIQKESTL 295
            .:.....:|.|  ..||..||  :.:..:|..:.::...||
plant   192 GLQANKTLPRD--EYIFVHKQRIMRENCSLRWHGVENGDTL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398 13/75 (17%)
UBQ 77..148 CDD:214563 12/71 (17%)
Ubiquitin 153..228 CDD:176398 22/88 (25%)
UBQ 153..224 CDD:214563 21/84 (25%)
UBQ 229..296 CDD:214563 15/69 (22%)
UBQ 229..296 CDD:294102 15/69 (22%)
AT2G32350NP_180794.2 Ubiquitin_like_fold 1..47 CDD:421700 9/45 (20%)
ubiquitin 77..146 CDD:395184 20/69 (29%)
Ubiquitin_like_fold 169..232 CDD:421700 14/64 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.