DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and DSK2

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_179311.1 Gene:DSK2 / 816225 AraportID:AT2G17200 Length:551 Species:Arabidopsis thaliana


Alignment Length:76 Identity:24/76 - (31%)
Similarity:39/76 - (51%) Gaps:10/76 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 LRLRGGMQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211
            :|...|.:..|||....|          :|:.|..:.....:|.:|||||:.|:.|:|.:||..|
plant    22 IRCSNGTKFSVKTSLDST----------VESFKELVAQSSDVPANQQRLIYKGRILKDDQTLLSY 76

  Fly   212 NIQKESTLHLV 222
            .:|.:.|:|:|
plant    77 GLQADHTIHMV 87

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398 1/4 (25%)