DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and UBTD1

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_079230.1 Gene:UBTD1 / 80019 HGNCID:25683 Length:227 Species:Homo sapiens


Alignment Length:67 Identity:23/67 - (34%)
Similarity:38/67 - (56%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 VKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 221
            |:..|||.:.|.....|::..:|.::|.:|||.|..||..|:||.|.|...|.:..|||:..:.:
Human   153 VRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQV 217

  Fly   222 VL 223
            ::
Human   218 II 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398
UBQ 77..148 CDD:214563
Ubiquitin 153..228 CDD:176398 23/67 (34%)
UBQ 153..224 CDD:214563 23/67 (34%)
UBQ 229..296 CDD:214563
UBQ 229..296 CDD:294102
UBTD1NP_079230.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
UBD 27..126 CDD:406775
Ubl_UBTD1 151..219 CDD:340640 23/65 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.